Recombinant Full Length Arabidopsis Thaliana Cyclic Nucleotide-Gated Ion Channel 4(Cngc4) Protein, His-Tagged
Cat.No. : | RFL2920AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Cyclic nucleotide-gated ion channel 4(CNGC4) Protein (Q94AS9) (1-694aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-694) |
Form : | Lyophilized powder |
AA Sequence : | MATEQEFTRASRFSRDSSSVGYYSEEDNTEEEDEEEEEMEEIEEEEEEEEEEDPRIGLTC GGRRNGSSNNNKWMMLGRILDPRSKWVREWNKVFLLVCATGLFVDPLFLYTLSVSDTCMC LLVDGWLALTVTALRSMTDLLHLWNIWIQFKIARRWPYPGGDSDGDTNKGGGTRGSTRVA PPYVKKNGFFFDLFVILPLPQVVLWVVIPSLLKRGSVTLVVSVLLVTFLFQYLPKIYHSI RHLRRNATLSGYIFGTVWWGIALNMIAYFVAAHAAGACWYLLGVQRSAKCLKEQCENTIG CDLRMLSCKEPVYYGTTVMVLDRARLAWAQNHQARSVCLDINTNYTYGAYQWTIQLVSSE SRLEKILFPIFWGLMTLSTFGNLESTTEWSEVVFNIIVLTSGLLLVTMLIGNIKVFLHAT TSKKQAMHLKMRNIEWWMKKRHLPIGFRQRVRNYERQRWAAMRGVDECEMVQNLPEGLRR DIKYHLCLDLVRQVPLFQHMDDLVLENICDRVKSLIFTKGETIQKEGDAVQRMLFVVRGH LQSSQLLRDGVKSCCMLGPGNFSGDELLSWCLRRPFVERLPPSSSTLVTLETTEAFGLDA EDVKYVTQHFRYTFVNEKVKRSARYYSPGWRTWAAVAVQLAWRRYKHRLTLTSLSFIRPR RPLSRCASLGEDKLRLYAAILTSPKPNPDDFDDY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CNGC4 |
Synonyms | CNGC4; HLM1; At5g54250; MDK4.7; Cyclic nucleotide-gated ion channel 4; AtCNGC4; Cyclic nucleotide- and calmodulin-regulated ion channel 4; AtHLM1 |
UniProt ID | Q94AS9 |
◆ Recombinant Proteins | ||
NDUFA2-5966M | Recombinant Mouse NDUFA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
YFHI-1880B | Recombinant Bacillus subtilis YFHI protein, His-tagged | +Inquiry |
RFL26732PF | Recombinant Full Length Populus Alba Cytochrome B6-F Complex Subunit 4(Petd) Protein, His-Tagged | +Inquiry |
IPCEF1-3086R | Recombinant Rat IPCEF1 Protein | +Inquiry |
RPL38-614Z | Recombinant Zebrafish RPL38 | +Inquiry |
◆ Native Proteins | ||
Laminin-33H | Native Human Laminin protein | +Inquiry |
PLG-27925TH | Native Human PLG | +Inquiry |
F10-290M | Active Native Mouse Factor X | +Inquiry |
Ferritin-024B | Native Bovine Ferritin Protein, holo form | +Inquiry |
Lectin-1850U | Active Native Ulex Europaeus Agglutinin I Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
BEX5-8462HCL | Recombinant Human BEX5 293 Cell Lysate | +Inquiry |
GB-2601CCL | Recombinant CMV GB cell lysate | +Inquiry |
SLC25A45-1759HCL | Recombinant Human SLC25A45 293 Cell Lysate | +Inquiry |
ARHGAP29-8739HCL | Recombinant Human ARHGAP29 293 Cell Lysate | +Inquiry |
Brain-779D | Dog Brain Membrane Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CNGC4 Products
Required fields are marked with *
My Review for All CNGC4 Products
Required fields are marked with *
0
Inquiry Basket