Recombinant Full Length Serpentine Receptor Class Gamma-7(Srg-7) Protein, His-Tagged
Cat.No. : | RFL5711CF |
Product Overview : | Recombinant Full Length Serpentine receptor class gamma-7(srg-7) Protein (P54129) (1-339aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-339) |
Form : | Lyophilized powder |
AA Sequence : | MASSPPIYNLEQYGTNCSEEYSNFYENSKYWIQCLWLIPTLFLLVWIIITTRVRYPSQYS NLPYWILTADCVVSIILILLDLFVVRLFLYFPQLCSKFSTIFINYPIISDIYFPIYNYAR VFKTGSQCGMILSRLFCVLIPFGHDEKLRRHIPLFLTIICILPILVVWNTVISEKEVVFW YGGFFVIYHRRVGWVSLSKLHLTFIFVSISFILISSLLLMRHLPIESAVNAERRVITNSI FIIVAFFFQAAFQSFYAFFRYTDWYPRFLVDFQFIIYDVMTVGYPLIFLNFAKEFRNHVF LKSNRKGRTLMELRSMSKPFNNTMPRQESPSPNYDSILA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | srg-7 |
Synonyms | srg-7; C18F10.8; Serpentine receptor class gamma-7; Protein srg-7 |
UniProt ID | P54129 |
◆ Recombinant Proteins | ||
KPNA2-1049H | Recombinant Human KPNA2, His-tagged | +Inquiry |
Yy2-017M | Recombinant Mouse Yy2 Protein, MYC/DDK-tagged | +Inquiry |
HNRNPR-1767H | Recombinant Human HNRNPR Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TTC1-5154H | Recombinant Human TTC1 protein, GST-tagged | +Inquiry |
RC3-8485Z | Recombinant Zebrafish RC3 | +Inquiry |
◆ Native Proteins | ||
SERPING1-73H | Native Human C1 Esterase inhibitor | +Inquiry |
FG-164B | Native Bovine fibrinogen degradation products | +Inquiry |
Neuraminidase-013C | Active Native Clostridium perfringens Neuraminidase Agarose, Type VI-A | +Inquiry |
HP-127H | Native Human Hemoglobin protein | +Inquiry |
PLE-105P | Active Native Porcine Esterase | +Inquiry |
◆ Cell & Tissue Lysates | ||
FANCL-6330HCL | Recombinant Human FANCL 293 Cell Lysate | +Inquiry |
RINT1-2336HCL | Recombinant Human RINT1 293 Cell Lysate | +Inquiry |
AGXT-8967HCL | Recombinant Human AGXT 293 Cell Lysate | +Inquiry |
P4HA2-3481HCL | Recombinant Human P4HA2 293 Cell Lysate | +Inquiry |
ANAPC4-73HCL | Recombinant Human ANAPC4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All srg-7 Products
Required fields are marked with *
My Review for All srg-7 Products
Required fields are marked with *
0
Inquiry Basket