Recombinant Full Length Serpentine Receptor Class Beta-6(Srb-6) Protein, His-Tagged
Cat.No. : | RFL31625CF |
Product Overview : | Recombinant Full Length Serpentine receptor class beta-6(srb-6) Protein (P54141) (1-337aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-337) |
Form : | Lyophilized powder |
AA Sequence : | MNDCDEVNNISYDPLYRYSQFYTLLTSIFSVFPLLYLIIFKLRVCTFNDNIKFLYIVYFT QILISVLNNCVVFAHHVVIPFLAVSKCDLLVNPVKNRIFQNIGVFGISCPMLTILGITAE RLLALIFARCYENVKLHIGVFIGVFAMLCDMALVYFFFLDEKFDQPSISYFMVPDTSGYK MNWLCYSLLAINSVNLVFNYFLVKINTILKEKWRNSLSTRYQMEENIITTKFSTFISFIH VFFFSLYLIFTLIIRLLGPGFLKTQADLMSVRGVYITIPTYNLIIGIASCVILRHLQRQK VAKVYAEVTLKYSGIDGAQIHQEAILNVWKTKSSGRK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | srb-6 |
Synonyms | srb-6; R05H5.6; Serpentine receptor class beta-6; Protein srb-6 |
UniProt ID | P54141 |
◆ Recombinant Proteins | ||
RFL24361BF | Recombinant Full Length Bacillus Anthracis Upf0344 Protein Bameg_3427 (Bameg_3427) Protein, His-Tagged | +Inquiry |
Nit1-4419M | Recombinant Mouse Nit1 Protein, Myc/DDK-tagged | +Inquiry |
FYTTD1-2428R | Recombinant Rat FYTTD1 Protein | +Inquiry |
UBASH3B-509H | Recombinant Human UBASH3B protein(Gln382-Glu649), His-tagged | +Inquiry |
RFL20407HF | Recombinant Full Length Human Protein Fam57B(Fam57B) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
C. albicans-38 | Native Candida albicans Antigen | +Inquiry |
HP-4387H | Native Human Haptoglobin | +Inquiry |
PROZ-5470H | Native Human Protein Z, Vitamin K-Dependent Plasma Glycoprotein | +Inquiry |
HP-127H | Native Human Hemoglobin protein | +Inquiry |
CASQ2-30C | Native Canine CASQ2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SYCE1-644HCL | Recombinant Human SYCE1 lysate | +Inquiry |
HYPM-208HCL | Recombinant Human HYPM lysate | +Inquiry |
MX1-4049HCL | Recombinant Human MX1 293 Cell Lysate | +Inquiry |
PCBP3-1290HCL | Recombinant Human PCBP3 cell lysate | +Inquiry |
DCTN6-7037HCL | Recombinant Human DCTN6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All srb-6 Products
Required fields are marked with *
My Review for All srb-6 Products
Required fields are marked with *
0
Inquiry Basket