Recombinant Full Length Sensor Protein Zras(Zras) Protein, His-Tagged
Cat.No. : | RFL25545SF |
Product Overview : | Recombinant Full Length Sensor protein ZraS(zraS) Protein (Q8Z332) (1-465aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella typhi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-465) |
Form : | Lyophilized powder |
AA Sequence : | MSFIRLHKDAAAMWLSRLLPAAIFILVGLFSIMVIRDYGRESAAARQTLLEKGNVLIRAL ESGTRVGMGMRMHHAQQQTLLEEMAGQPGVLWFAVTDAQGVIITHSNPGMVGKSLYSPSE MHQLNPGPQECWRRVDVAANGETVPALEIYRQFQPLFGMRGHGMRGHGMARSANDDEPAK QTIFIAFDASELAATQAREWRNTLIVLSALAAVLLATLLAFFWYQRYQRSHRELLDAMKR KEKLVAMGHLAAGVAHEIRNPLSSIKGLAKYFAERTPAGGESHELAQVMAKEADRLNRVV SELLELVKPAHLTLQAVNLNDIITHSLNLVSQDAQSREIQLRFTANETLKRIQADPDRLT QVLLNLYLNAIHAIGRQGTITVEAKESGTDRVIITVTDSGKGIAPDQLEAIFTPYFTTKA DGTGLGLAVVQNIIEQHGGAIKVKSIEGKGAVFTIWLPVIARQQD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | zraS |
Synonyms | zraS; hydH; STY3712; t3458; Sensor protein ZraS |
UniProt ID | Q8Z332 |
◆ Recombinant Proteins | ||
TFF1-27974TH | Recombinant Human TFF1, His-tagged | +Inquiry |
RFL29060BF | Recombinant Full Length Burkholderia Pseudomallei Probable Ubiquinone Biosynthesis Protein Ubib(Ubib) Protein, His-Tagged | +Inquiry |
STAT5B-74H | Recombinant Human STAT5B, GST-tagged | +Inquiry |
Nxn-4562M | Recombinant Mouse Nxn Protein, Myc/DDK-tagged | +Inquiry |
Hcrt-2652R | Recombinant Rat Hcrt protein, His & GST-tagged | +Inquiry |
◆ Native Proteins | ||
alpha Thrombin native protein-3287H | Native Human alpha Thrombin | +Inquiry |
C8-103H | Native Human C8 Protein | +Inquiry |
NEFH-01P | Native Pig NEFH Protein | +Inquiry |
Ighg2a-161M | Native Mouse Immunoglobulin G2a | +Inquiry |
IgG-01H | Native Human Immunoglobulin G | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTPRO-2673HCL | Recombinant Human PTPRO 293 Cell Lysate | +Inquiry |
ST3GAL3-1441HCL | Recombinant Human ST3GAL3 293 Cell Lysate | +Inquiry |
Pancreas-670H | Hamster Pancreas Lysate, Total Protein | +Inquiry |
EPHB2-001MCL | Recombinant Mouse EPHB2 cell lysate | +Inquiry |
SPATA18-1539HCL | Recombinant Human SPATA18 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All zraS Products
Required fields are marked with *
My Review for All zraS Products
Required fields are marked with *
0
Inquiry Basket