Recombinant Human TFF1, His-tagged

• Cat.No.: TFF1-27974TH
• Product Overview: Recombinant full length Human Estrogen Inducible Protein pS2 with N terminal His tag; 81 amino acids with tag, Predicted MWt 9.0 kDa.

Specification

• Description: Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer, and affect healing of the epithelium. This gene, which is expressed in the gastric mucosa, has also been studied because of its expression in human tumors. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21.
• Protein length: 60 amino acids
• Conjugation: HIS
• Molecular Weight: 9.000kDa inclusive of tags
• Source: E. coli
• Tissue specificity: Found in stomach, with highest levels in the upper gastric mucosal cells (at protein level). Detected in goblet cells of the small and large intestine and rectum, small submucosal glands in the esophagus, mucous acini of the sublingual gland, submucosal g
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, 0.1mM PMSF, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMEAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF
• Sequence Similarities: Contains 1 P-type (trefoil) domain.

Gene Information

• Gene Name: TFF1 trefoil factor 1 [ Homo sapiens ]
• Official Symbol: TFF1
• Synonyms: TFF1; trefoil factor 1; BCEI, breast cancer, estrogen inducible sequence expressed in; D21S21; HP1.A; HPS2; pNR 2; pS2
• Gene ID: 7031
• mRNA Refseq: NM_003225
• Protein Refseq: NP_003216
• MIM: 113710
• Uniprot ID: P04155
• Chromosome Location: 21q22.3
• Pathway: FOXA1 transcription factor network, organism-specific biosystem
• Function: growth factor activity; protein binding