Recombinant Full Length Sendai Virus Hemagglutinin-Neuraminidase(Hn) Protein, His-Tagged
Cat.No. : | RFL23874SF |
Product Overview : | Recombinant Full Length Sendai virus Hemagglutinin-neuraminidase(HN) Protein (Q88261) (1-575aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sendai virus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-575) |
Form : | Lyophilized powder |
AA Sequence : | MDGDRSKRDSYWSTSPGGSTTKLVSDSERSGKVDTWLLILAFTQWALSIATVIICIVIAA RQGYSMERYSMTVEALNTSNKEVKESLTSLIRQEVITRAANIQSSVQTGIPVLLNKNSRD VIRLIEKSCNRQELTQLCDSTIAVHHAEGIAPLEPHSFWRCPAGEPYLSSDPEVSLLPGP SLLSGSTTISGCVRLPSLSIGEAIYAYSSNLITQGCADIGKSYQVLQLGYISLNSDMFPD LNPVVSHTYDINDNRKSCSVVATGTRGYQLCSMPIVDERTDYSSDGIEDLVLDILDLKGR TKSHRYSNSEIDLDHPFSALYPSVGSGIATEGSLIFLGYGGLTTPLQGDTKCRIQGCQQV SQDTCNEALKITWLGGKQVVSVLIQVNDYLSERPRIRVTTIPITQNYLGAEGRLLKLGDQ VYIYTRSSGWHSQLQIGVLDVSHPLTISWTPHEALSRPGNEDCNWYNTCPKECISGVYTD AYPLSPDAANVATVTLYANTSRVNPTIMYSNTTNIINMLRIKDVQLEAAYTTTSCITHFG KGYCFHIIEINQKSLNTLQPMLFKTSIPKLCKAES |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HN |
Synonyms | HN; Hemagglutinin-neuraminidase; HN protein; Protein HANA |
UniProt ID | Q88261 |
◆ Recombinant Proteins | ||
Egf-053M | Active Recombinant Mouse Egf Protein | +Inquiry |
Mttp-7973M | Recombinant Mouse Mttp protein, His & T7-tagged | +Inquiry |
S100A8/S100A9-10H | Recombinant Human S100A8/S100A9 Complex Protein | +Inquiry |
RFL6051RF | Recombinant Full Length Rat N-Arachidonyl Glycine Receptor(Gpr18) Protein, His-Tagged | +Inquiry |
CRBN-2793H | Recombinant Human CRBN Full Length Transmembrane protein, C-9xHis-tagged | +Inquiry |
◆ Native Proteins | ||
HSP90AA1-14H | Native Hsp90 Protein | +Inquiry |
GSN-876P | Active Native Porcine GSN Protein | +Inquiry |
C3b-06M | Native Mouse C3b Protein | +Inquiry |
Immunoglobulin D-79H | Native Human Immunoglobulin D | +Inquiry |
PRSS1-30745TH | Active Native Human PRSS1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GUCA1C-5678HCL | Recombinant Human GUCA1C 293 Cell Lysate | +Inquiry |
BTG1-8393HCL | Recombinant Human BTG1 293 Cell Lysate | +Inquiry |
Heart Atrium-203H | Human Heart Atrium (RT) (Diseased) Lysate | +Inquiry |
CDKN2C-7612HCL | Recombinant Human CDKN2C 293 Cell Lysate | +Inquiry |
NPS-3729HCL | Recombinant Human NPS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HN Products
Required fields are marked with *
My Review for All HN Products
Required fields are marked with *
0
Inquiry Basket