Recombinant Full Length Human Parainfluenza 4A Virus Hemagglutinin-Neuraminidase(Hn) Protein, His-Tagged
Cat.No. : | RFL20577HF |
Product Overview : | Recombinant Full Length Human parainfluenza 4a virus Hemagglutinin-neuraminidase(HN) Protein (P21526) (1-573aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | HPIV4a |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-573) |
Form : | Lyophilized powder |
AA Sequence : | MQDSHGNTQILNQANSMVKRTWRLLFRIATLILLVSIFVLSLIIVLQSTPGNLQNDINII RKELNELMENFETTSKSLLSVSNQITYDVSVLTPIRQEAIETNIISKIKDHCKDRVIKEG STCTLNRSPLHDVSFLNGFNKFYFTYKDNMQIKFKSLLDYPNFIPTATTPHGCIRIPSFS LGQTHWCYTHNINLLGCADPASSNQYVSLGTLQVLKMGDPYFKVEHSHYLNDGRNRKSCS VVAVPDGCLRNCVTMTKNETENFKDLNWQHNYLHTYHIMVPLKTRIINPPGSSRDWVHIA PGVGSGLLYAKLLIFPLYGGLTEKSVIHNNQSGKYFFPNSTKLQCRNSTMEKIKGAKDSY TITYFSGRLIQSAFLVCDLRQFLSEDCEILIPSNDYMMVGAEGRLYNIENNIFYYQRGSS WWPYPSLYRIRLNLSKKYPRITEIKFTKIEIAPRPGNKDCPGNKACPKECITGVYQDILP LSYPNTAFPHLKQAYYTGFYLNNSLERRNPTFYTADNLDYHQQERLGKFNLTAGYSTTTC FKQTTTARLYCLYIIEVGDSVIGDFQITLFLAA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HN |
Synonyms | HN; Hemagglutinin-neuraminidase |
UniProt ID | P21526 |
◆ Recombinant Proteins | ||
mutM-88E | Recombinant E.coli Fpg, His-tagged | +Inquiry |
ACVR2B-2182C | Active Recombinant Cynomolgus ACVR2B protein, hFc-tagged | +Inquiry |
HA-223I | Recombinant Influenza B (B/Wisconsin/01/2012) HA1 Protein, His-tagged | +Inquiry |
Pcdhb6-1918M | Recombinant Mouse Pcdhb6 Protein, His-tagged | +Inquiry |
Rbp3-513M | Recombinant Mouse Rbp3 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
GGT1-371P | Native Porcine Gamma-Glutamyltransferase 1 | +Inquiry |
Complement C1-42H | Native Human Complement C1 | +Inquiry |
ALB-7993H | Native Human Serum Albumin(20% Solution) | +Inquiry |
LDH1-16H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
NEFH-180B | Native bovine NEFH | +Inquiry |
◆ Cell & Tissue Lysates | ||
SUSD3-1335HCL | Recombinant Human SUSD3 293 Cell Lysate | +Inquiry |
K1-002CCL | Chinese Hamster K1 Whole Cell Lysate | +Inquiry |
CD1C-7682HCL | Recombinant Human CD1C 293 Cell Lysate | +Inquiry |
FBXL21-6312HCL | Recombinant Human FBXL21 293 Cell Lysate | +Inquiry |
TAF2-1269HCL | Recombinant Human TAF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HN Products
Required fields are marked with *
My Review for All HN Products
Required fields are marked with *
0
Inquiry Basket