Recombinant Full Length Secale Cereale Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL17890SF |
Product Overview : | Recombinant Full Length Secale cereale Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (P09447) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Secale cereale (Rye) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLLAVHIMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITDSWGGWSISGGTVTNPGIWSYEGVAGTHIVFSGLCFLAAIWHWVYWDL EIFSDERTGKPSLDLPKIFGIHLFLAGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQA VNPAWGAEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSNGLAENLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPVFRDKEGRELFVRRMP TFFETFPVVLVDEEGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRSQLGEIFELDRATLKSDGVFRSSPRGWFTFGHATFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGTFQKVGDPTTRKQAV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | P09447 |
◆ Recombinant Proteins | ||
ST3GAL5-4500R | Recombinant Rhesus monkey ST3GAL5 Protein, His-tagged | +Inquiry |
CCHCR1-2915HF | Recombinant Full Length Human CCHCR1 Protein, GST-tagged | +Inquiry |
CCDC69-2876HF | Recombinant Full Length Human CCDC69 Protein, GST-tagged | +Inquiry |
KDR-6865H | Recombinant Human KDR protein, His-tagged | +Inquiry |
HSF5-7894M | Recombinant Mouse HSF5 Protein | +Inquiry |
◆ Native Proteins | ||
Trypsin-265H | Native Human Trypsin | +Inquiry |
Lectin-1784G | Active Native Griffonia Simplicifolia Lectin I isolectin B4 Protein, DyLight 649 Labeled | +Inquiry |
DNA-005C | Native Calf DNA | +Inquiry |
APOA1-5301H | Native Human Apolipoprotein A-I | +Inquiry |
GPD-189R | Active Native Rabbit Glycerol-3-phosphate dehydrogenase | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC25A12-1783HCL | Recombinant Human SLC25A12 293 Cell Lysate | +Inquiry |
CRABP2-7295HCL | Recombinant Human CRABP2 293 Cell Lysate | +Inquiry |
LEPR-2175HCL | Recombinant Human LEPR cell lysate | +Inquiry |
SLC35F5-1631HCL | Recombinant Human SLC35F5 cell lysate | +Inquiry |
DNASE2-6863HCL | Recombinant Human DNASE2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket