Recombinant Full Length Ranunculus Macranthus Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL18768RF |
Product Overview : | Recombinant Full Length Ranunculus macranthus Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (Q4FFM9) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ranunculus macranthus (Large buttercup) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLLAVHIMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTITNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL QIFCDERTGKPSLDLPKIFGIHLFLSGLACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQS VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVGAGLAENKSLSD VWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELDGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTKRQVV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | Q4FFM9 |
◆ Recombinant Proteins | ||
HYI-10658Z | Recombinant Zebrafish HYI | +Inquiry |
SOD3-586HFL | Recombinant Full Length Human SOD3 Protein, C-Flag-tagged | +Inquiry |
NPY5R-6663HF | Recombinant Full Length Human NPY5R Protein | +Inquiry |
Esrrb-1091M | Recombinant Mouse Esrrb protein, His & T7-tagged | +Inquiry |
LRRC8A-4646H | Recombinant Human LRRC8A Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
CRP-159M | Native Rhesus Monkey C-Reactive Protein | +Inquiry |
Lectin-1790G | Active Native Griffonia Simplicifolia Lectin II Protein | +Inquiry |
C5-53H | Native Human Complement C5 | +Inquiry |
LDL-401H | Native Human Low Density Lipoprotein, Medium Oxidized, DiI labeled | +Inquiry |
SPARC-287B | Native Bovine Osteonectin | +Inquiry |
◆ Cell & Tissue Lysates | ||
STC1-1412HCL | Recombinant Human STC1 293 Cell Lysate | +Inquiry |
TBX22-1200HCL | Recombinant Human TBX22 293 Cell Lysate | +Inquiry |
ANXA2-8834HCL | Recombinant Human ANXA2 293 Cell Lysate | +Inquiry |
ORMDL2-3547HCL | Recombinant Human ORMDL2 293 Cell Lysate | +Inquiry |
XRCC5 & XRCC6-543HCL | Recombinant Human XRCC5 & XRCC6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket