Recombinant Full Length Oryza Sativa Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL31147OF |
Product Overview : | Recombinant Full Length Oryza sativa Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (P0C362) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rice |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLLSVHIMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSISGGTVTNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLAGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQA VNPAWGAEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSDGLAENLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLVDEEGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRSQLGEIFELDRATLKSDGVFRSSPRGWFTFGHATFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGTFQKVGDPTTRRQPV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; PA090; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | P0C362 |
◆ Recombinant Proteins | ||
SPON2-32HFL | Recombinant Human SPON2 Protein, Full Length, N-6×His tagged | +Inquiry |
RICTOR-3306H | Recombinant Human RICTOR protein, His-tagged | +Inquiry |
ANKS3-2162H | Recombinant Human ANKS3 Protein, MYC/DDK-tagged | +Inquiry |
GPX3-219H | Recombinant Human GPX3 | +Inquiry |
TRIM50-6280R | Recombinant Rat TRIM50 Protein | +Inquiry |
◆ Native Proteins | ||
ACTC1-885B | Native Bovine ACTC1 Protein, Pyrene labeled | +Inquiry |
IgG-011H | Native Human Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
ALB-584P | Native Guinea Pig ALB protein | +Inquiry |
TnI-1050H | Native Human Cardiac Troponin I | +Inquiry |
RNASE2-171H | Native Human Eosinophil Derived Neurotoxin | +Inquiry |
◆ Cell & Tissue Lysates | ||
Fetus-185M | Mouse Fetus (15 Day Fetus) Lysate | +Inquiry |
AIF1-8956HCL | Recombinant Human AIF1 293 Cell Lysate | +Inquiry |
PPARA-2987HCL | Recombinant Human PPARA 293 Cell Lysate | +Inquiry |
VNN2-2268HCL | Recombinant Human VNN2 cell lysate | +Inquiry |
UBE2A-594HCL | Recombinant Human UBE2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket