Recombinant Full Length Sebaldella Termitidis Protein Translocase Subunit Secd(Secd) Protein, His-Tagged
Cat.No. : | RFL19399SF |
Product Overview : | Recombinant Full Length Sebaldella termitidis Protein translocase subunit SecD(secD) Protein (D1AMK9) (1-406aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sebaldella termitidis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-406) |
Form : | Lyophilized powder |
AA Sequence : | MEIKTSRIVILILVVVIPAILIFRNPINLGLDLRGGTSVVLEAQEEDGKKLQPDTMDKVR EIVQRRVDGLGVSEPVIQKSGENRLIVELAGVKDAQEAIDLIGTTAKLEFKIKTGDNSYG PTVLDGSAIKNAYVQQDQFGKPMIGFELNDEGAVKFAEITRTNMGKQLAIMLDGKEQSAP VIQSEIPGGKGSISGSFTYESAQNLANLLKAGALPVNIQIMETRSVDASLGAESIKATKM AAMIALVLVSLFMLAVYRVAGFVADLALCVFGILTAGLMCAIGTTLTLPGIAGFILSLGM AVDANVIIFERIKDEIMEGKRFQDCIDDGFNRAFPAILDGNITTLLITMVLFFFGTGPVR GFAVILTIGVLVSMFTAIFITKIIVKIFVNIFHLNGEKLFGLKGVE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | secD |
Synonyms | secD; Sterm_2738; Protein translocase subunit SecD |
UniProt ID | D1AMK9 |
◆ Recombinant Proteins | ||
TSKU-6058HF | Recombinant Full Length Human TSKU Protein, GST-tagged | +Inquiry |
BAIAP2-301317H | Recombinant Human BAIAP2 protein, GST-tagged | +Inquiry |
YWNH-1479B | Recombinant Bacillus subtilis YWNH protein, His-tagged | +Inquiry |
EPO-3602Z | Recombinant Zebrafish EPO | +Inquiry |
RFL24269SF | Recombinant Full Length Schizosaccharomyces Pombe Uncharacterized Membrane Protein C1281.03C (Spcc1281.03C) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
ASOM-37 | Active Native L-ascorbate oxidase | +Inquiry |
Lectin-1828P | Active Native Pisum Sativum Agglutinin Protein, Biotinylated | +Inquiry |
RSV-09 | Native Respiratory Syncytial Virus (RSV) Antigen | +Inquiry |
APOB-1H | Native Human Apolipoprotein B | +Inquiry |
Plg-1897R | Native Rat Plasminogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
KDM5B-4992HCL | Recombinant Human KDM5B 293 Cell Lysate | +Inquiry |
SPATA4-1534HCL | Recombinant Human SPATA4 293 Cell Lysate | +Inquiry |
ZNF79-8HCL | Recombinant Human ZNF79 293 Cell Lysate | +Inquiry |
HOXA3-5426HCL | Recombinant Human HOXA3 293 Cell Lysate | +Inquiry |
NAB1-3989HCL | Recombinant Human NAB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All secD Products
Required fields are marked with *
My Review for All secD Products
Required fields are marked with *
0
Inquiry Basket