Recombinant Full Length Petrotoga Mobilis Protein Translocase Subunit Secd(Secd) Protein, His-Tagged
Cat.No. : | RFL414PF |
Product Overview : | Recombinant Full Length Petrotoga mobilis Protein translocase subunit SecD(secD) Protein (A9BG79) (1-472aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Petrotoga mobilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-472) |
Form : | Lyophilized powder |
AA Sequence : | MRNRRIRILFTVIVFVFALLGLILPLSGNVNDISILRFFPNINLGLDIQGGVLLEYSFDV PEGVNTSEVVDNVITVLRRRMDNAGYTEAIVSEVVSGGESRVRVEIPGISDTQRAEELIG SKGKLYFAEVLEVVESTTTPEITRNRTIQINGEEIEMYSYVKDSNNPNLWYRVKNVFEFG DAPFQITGLDVTDAVASLNSQGAGFVVNLNFSNEGRQKFELATANLVNERIAIILDDEVI IAPVVRERISQGRAEISGIESMEEAQNIAVLIKSGNLPVDLVKYQERTLGPTLGRDIVTT IINAGIIGLIIVMIYMIIFYRWMGVIADIALIYNTFLLMGILSWTGAILTLPGIAGIILT FGTTVDGNIIIYERIKEELRIGRPPLTAVKFGFNKVFSTIFDANITTILAGLVLFFVTSG SIRGFAVTLIIGVLGAMFTNLVVSRLLLESTSHFLKPEKYVKGIVVEKGGTK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | secD |
Synonyms | secD; Pmob_1116; Protein translocase subunit SecD |
UniProt ID | A9BG79 |
◆ Recombinant Proteins | ||
OLR1174-3835R | Recombinant Rat OLR1174 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL36458HF | Recombinant Full Length Human Radiation-Inducible Immediate-Early Gene Iex-1(Ier3) Protein, His-Tagged | +Inquiry |
CCL7-46M | Recombinant Mouse chemokine (C-C motif) ligand 7 (CCL7) | +Inquiry |
FZD8-2432R | Recombinant Rat FZD8 Protein | +Inquiry |
GNAL-7017M | Recombinant Mouse GNAL Protein | +Inquiry |
◆ Native Proteins | ||
PLG-1867B | Native Bovine PLG Protein | +Inquiry |
H3N20799-215I | Native H3N2 (A/Panama/2007/99) H3N20799 protein | +Inquiry |
TPO-702H | Native Human Thyroid Peroxidase | +Inquiry |
GGT1-8131H | Native Human Liver Gamma Glutamyl Transpeptidase | +Inquiry |
APCS-8258H | Native Human Serum Amyloid P | +Inquiry |
◆ Cell & Tissue Lysates | ||
COX5A-389HCL | Recombinant Human COX5A cell lysate | +Inquiry |
RPP30-2179HCL | Recombinant Human RPP30 293 Cell Lysate | +Inquiry |
KIR2DL1-1657HCL | Recombinant Human KIR2DL1 cell lysate | +Inquiry |
METTL6-1084HCL | Recombinant Human METTL6 cell lysate | +Inquiry |
Uterus-549H | Human Uterus Membrane Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All secD Products
Required fields are marked with *
My Review for All secD Products
Required fields are marked with *
0
Inquiry Basket