Recombinant Full Length Haloferax Volcanii Protein Translocase Subunit Secd(Secd) Protein, His-Tagged
Cat.No. : | RFL4859HF |
Product Overview : | Recombinant Full Length Haloferax volcanii Protein translocase subunit SecD(secD) Protein (D4GTK5) (1-524aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Haloferax volcanii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-524) |
Form : | Lyophilized powder |
AA Sequence : | MSTLRDNWRVIFLVAAILLSTFALFSPTMGNQSPIGEDDSATNLQFGLQLDGGTRIRAPL VGVTAEDVEFEGDSERVVERQVAAQIAGADAADIIVRTGAESSTVEATIENVTADDLSAA LDAAGYAHGEVRDGVTGTTRAETVRVLQSKINEAGLSGGTVQQVTTATGEHFILVEVPNR DQSDVVDLVGERGTVQIDIYYPTGTDNGSRTYETREAVLTQADFTSIGTAQESQTGSGAF VPVSVRDDPAAEFQTAIQDTGLAQPGGTRCTYMEDGGRNTTEGCLLLVVNGEVVNAFGMS GGLADTMRAGEWAGAPSFQLQTRNTSEAQEIAINLRAGALPARLDLSGEDSGTSSYISPS QGESFKFDSLITGIVAVLAVAGVVFIRYGKPQVALPMIVTGLSEVYILLGFAAAIGYPLD LSVIAGFIAVIGTGVDDLIIIADEVMGEGSVKSRKVFQSRFRRAFWVIGAAAATTIIAMS PLAVLSLGDLQGFAIFTILGVIVGVLVTRPAYGDILRLLLTEDR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | secD |
Synonyms | secD; HVO_1976; Protein-export membrane protein SecD |
UniProt ID | D4GTK5 |
◆ Recombinant Proteins | ||
RFL26384PF | Recombinant Full Length Psilotum Nudum Photosystem Ii Cp43 Chlorophyll Apoprotein(Psbc) Protein, His-Tagged | +Inquiry |
GCNT4-6273M | Recombinant Mouse GCNT4 Protein | +Inquiry |
BSDC1-359H | Recombinant Human BSDC1 Protein, GST-tagged | +Inquiry |
LHBETA1-11658Z | Recombinant Zebrafish LHBETA1 | +Inquiry |
RFL30514OF | Recombinant Full Length Oryza Sativa Subsp. Japonica Oleosin 18 Kda(Ole18) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
ung-8332E | Native E.coli ung | +Inquiry |
Lectin-1742W | Active Native Wisteria Floribunda Lectin Protein | +Inquiry |
GALM-40P | Active Native Porcine Mutarotase | +Inquiry |
EGF-26462TH | Native Human EGF | +Inquiry |
HP-191E | Native Equine Haptoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
RSV-F-722RCL | Recombinant RSV RSV-F cell lysate | +Inquiry |
MREG-4210HCL | Recombinant Human MREG 293 Cell Lysate | +Inquiry |
Lung-541E | Equine Lung Lysate, Total Protein | +Inquiry |
GRM4-5734HCL | Recombinant Human GRM4 293 Cell Lysate | +Inquiry |
PPP6R2-1560HCL | Recombinant Human PPP6R2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All secD Products
Required fields are marked with *
My Review for All secD Products
Required fields are marked with *
0
Inquiry Basket