Recombinant Full Length Haloquadratum Walsbyi Protein Translocase Subunit Secd(Secd) Protein, His-Tagged
Cat.No. : | RFL17030HF |
Product Overview : | Recombinant Full Length Haloquadratum walsbyi Protein translocase subunit SecD(secD) Protein (Q18FQ8) (1-520aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Haloquadratum walsbyi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-520) |
Form : | Lyophilized powder |
AA Sequence : | MIDFRENWRIILLVIVVIVSLFALVSPTLASGPDSNSAVVQQSSQTNLQYGLELAGGTRV RAPLVGVTAEEVEFEPANAREVEQRIATAIDGAGPADVIARPVTETTGTVEVTVEGVSTT ELQSILESTGYTASTVRTGVTETTRQEVVRILENKINEAGLSGGTVQEVTTAGGGHFILI EVPNEDAASVRSLVSERGTVVVQAHYPQDDIYTQQTVLQQDNFQSIGSAQEGQSGGAYVP VTVRESAANEFQQATVDTTLARPGGTRCTYSRDQNSTEPCLLLVVNGEVTNSFGMAPRLA DSLRGGSWAQDPVFQLQTANVSEAQEVAINLRAGALPAKLDLTGDDGGTTSFISPSQGEN FRTDSLLAGLVAVFAVSGVVFLRYRDARVALPMIVTALSEVLILLGFAAGIGYPLDLSVI AGFITVIGTGVDDLVIIADEVLAEGGVSSRRVFQSRFRRAFWVIGAAAATTIIAMSPLAI LSLGDLQGFAIFTILGVLVGVLITRPAYGDILRALTTGNL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | secD |
Synonyms | secD; HQ_3097A; Protein-export membrane protein SecD |
UniProt ID | Q18FQ8 |
◆ Recombinant Proteins | ||
CHCHD6-840R | Recombinant Rhesus monkey CHCHD6 Protein, His-tagged | +Inquiry |
RBP1-2744H | Recombinant Human RBP1 Protein (Asp64-Gln197), His tagged | +Inquiry |
LEPR-800H | Recombinant Human LEPR protein(Met1-Asp839), His&hFc-tagged | +Inquiry |
RFL21302BF | Recombinant Full Length Bovine C-C Chemokine Receptor Type 5(Ccr5) Protein, His-Tagged | +Inquiry |
SNAPC5-1755C | Recombinant Chicken SNAPC5 | +Inquiry |
◆ Native Proteins | ||
F9-26523H | Active Native Human F9 Protein | +Inquiry |
LDH-15H | Native Human Lactate Dehydrogenase | +Inquiry |
Cela1 -71R | Active Native Rat pancreatic elastase | +Inquiry |
PTGS1-58S | Native Sheep PTGS1 Protein | +Inquiry |
Lecithin-08E | Native Egg Yolk Lecithin | +Inquiry |
◆ Cell & Tissue Lysates | ||
SIP1-1836HCL | Recombinant Human SIP1 293 Cell Lysate | +Inquiry |
TCEAL5-1190HCL | Recombinant Human TCEAL5 293 Cell Lysate | +Inquiry |
PKM2-3152HCL | Recombinant Human PKM2 293 Cell Lysate | +Inquiry |
ECT2-6728HCL | Recombinant Human ECT2 293 Cell Lysate | +Inquiry |
ACVR2B-734CCL | Recombinant Cynomolgus ACVR2B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All secD Products
Required fields are marked with *
My Review for All secD Products
Required fields are marked with *
0
Inquiry Basket