Recombinant Full Length Schizosaccharomyces Pombe Uncharacterized Zinc Transporter P8A3.03(Spap8A3.03) Protein, His-Tagged
Cat.No. : | RFL29148SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Uncharacterized zinc transporter P8A3.03(SPAP8A3.03) Protein (Q9UT11) (24-453aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (24-453) |
Form : | Lyophilized powder |
AA Sequence : | EKHFEAEEYRDSFLSQENMNKINHTTIERLFREMTENDPSLLSSSKTLAELSKGELAKAR EDLKSVLSFLKNNLPVDTESSSEAFTIEKDNNSCVWLNSVKSFVEKQFSYSSGTNGILAT FLTAIPPNIFILLVPKSFDTSMLNLFVAVSAGSLLGDVFLQLLPTVYSTNGGDFPASSVY SILIGALVFFLMDKGIRILIHERPSSLSKPKKDGEETSSVNKPSASSTQTDVKGVEGLRK RNVKDDQNSKGHEPDLIRHVVEEVSEEYNDKTVVYLNLLCDSFHNFMDGLAITSAFFTNT SIGISTTFAVLLHEIPAEIGDLAILLRNGYTKSQVLVLQMITMVTGLLGAIVATYIYTAS SSSSPYGSFLLQLEDKLLPFTAGGFLYIAYLGVFPELLEINLSKGKLGNMIYTALYMMFI VGGFSFLYYV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SPAP8A3.03 |
Synonyms | SPAP8A3.03; Uncharacterized zinc transporter P8A3.03 |
UniProt ID | Q9UT11 |
◆ Recombinant Proteins | ||
CHKA-5412H | Recombinant Human CHKA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CCL3-169H | Recombinant Human CCL3 protein, His-tagged | +Inquiry |
ARL5C-1936M | Recombinant Mouse ARL5C Protein | +Inquiry |
PSMA8-30593TH | Recombinant Human PSMA8, His-tagged | +Inquiry |
RFL8726DF | Recombinant Full Length Dehalococcoides Ethenogenes Atp Synthase Subunit C(Atpe) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Collagen type I-01H | Native Human Collagen type I Protein | +Inquiry |
F10-290M | Active Native Mouse Factor X | +Inquiry |
H3N2993-216I | Native H3N2 (A/Shandong/9/93) H3N2993 protein | +Inquiry |
C. jejuni-24 | Native Campylobacter jejuni Antigen | +Inquiry |
COL2A1-1647H | Native Human COL2A1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
C16orf70-8247HCL | Recombinant Human C16orf70 293 Cell Lysate | +Inquiry |
DDX50-7003HCL | Recombinant Human DDX50 293 Cell Lysate | +Inquiry |
ITGB1BP3-879HCL | Recombinant Human ITGB1BP3 cell lysate | +Inquiry |
CARD14-282HCL | Recombinant Human CARD14 cell lysate | +Inquiry |
AK4-001HCL | Recombinant Human AK4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPAP8A3.03 Products
Required fields are marked with *
My Review for All SPAP8A3.03 Products
Required fields are marked with *
0
Inquiry Basket