Recombinant Full Length Schizosaccharomyces Pombe Uncharacterized Ubiquitin-Like Protein C1E8.02 (Spbc1E8.02) Protein, His-Tagged
Cat.No. : | RFL20152SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Uncharacterized ubiquitin-like protein C1E8.02 (SPBC1E8.02) Protein (O42967) (1-603aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-603) |
Form : | Lyophilized powder |
AA Sequence : | MSEYRIRVTTVDQKVGIFQVPRTKTVLELKELIAVTFEAPADRLKLIHAGRVLRNETPLE EILHDATDLVTFHLVIAVFNSTSTTLPSATSSSVPQSRTSELSSTNSIPTPRITSLNPEE LSRRERAQRLLQTYNSFHGSGLGGLFPNIHRELESHGFSLPTHEQSSPVAESLDNSVSSA LSPHLETLRRRNLSIHHQHIQAHEMAQESLETRNPGNISSSSAPLASDQSPTVSSNHIHA SGNLALGSNSGLNPRSPNSFSSPLDNPALHTVDSTNVNGSLSPLSNSSSINQVHQNETHG STISVPNPNLSQMGPSHSSSVPSNLSPNPAQNENPSTTSIPSINNQPFPSGLSASNSNFA SSSFIPQSVPQLLPIYYQTIFYNGNYYLQQLPSASPPTMFRDHSFAPLVSPSIVSPYGVL ENEETGECAFLFSPNASQPHFQPRAPTFGIPRNVRSLFTLPFFHTIRNIERHFRLFIRLA LFCVLTTYNVSLSQTILLTSIMSVVFLLQTGALAPFINDNPLIQSGMRHIRNLQDEYRRR RNRTAQRVVEIPNETQTEDEQDGTNTPDNRADAEERELTRSQRIYRTVVRTIVAFALSFV PRA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SPBC1E8.02 |
Synonyms | SPBC1E8.02; Uncharacterized ubiquitin-like protein C1E8.02 |
UniProt ID | O42967 |
◆ Recombinant Proteins | ||
NXF1-4135R | Recombinant Rat NXF1 Protein | +Inquiry |
DNAJC15-3997HF | Recombinant Full Length Human DNAJC15 Protein, GST-tagged | +Inquiry |
FUT1-5173HF | Recombinant Full Length Human FUT1 Protein, GST-tagged | +Inquiry |
OPN1MW-3729H | Recombinant Human OPN1MW Protein, His (Fc)-Avi-tagged | +Inquiry |
TNIK-1499H | Active Recombinant Human TNIK, GST-tagged | +Inquiry |
◆ Native Proteins | ||
AMY2A-8353H | Native Human AMY2A | +Inquiry |
ALPL-8004H | Native Human Liver Alkaline Phosphatase | +Inquiry |
Actin-889P | Native Porcine Actin Protein | +Inquiry |
PGN-17S | Native S. aureus PGN Protein | +Inquiry |
Prostate-016H | Human Prostate Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MTHFD2-4082HCL | Recombinant Human MTHFD2 293 Cell Lysate | +Inquiry |
SUV420H2-1331HCL | Recombinant Human SUV420H2 293 Cell Lysate | +Inquiry |
UBL5-553HCL | Recombinant Human UBL5 293 Cell Lysate | +Inquiry |
CD59A-1712MCL | Recombinant Mouse CD59A cell lysate | +Inquiry |
KATNAL2-5085HCL | Recombinant Human KATNAL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPBC1E8.02 Products
Required fields are marked with *
My Review for All SPBC1E8.02 Products
Required fields are marked with *
0
Inquiry Basket