Recombinant Full Length Human FUT1 Protein, GST-tagged

Cat.No. : FUT1-5173HF
Product Overview : Human FUT1 full-length ORF ( NP_000139.1, 1 a.a. - 365 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 365 amino acids
Description : The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway. This gene is one of two encoding the galactoside 2-L-fucosyltransferase enzyme. Mutations in this gene are a cause of the H-Bombay blood group. [provided by RefSeq
Molecular Mass : 67.7 kDa
AA Sequence : MWLRSHRQLCLAFLLVCVLSVIFFLHIHQDSFPHGLGLSILCPDRRLVTPPVAIFCLPGTAMGPNASSSCPQHPASLSGTWTVYPNGRFGNQMGQYATLLALAQLNGRRAFILPAMHAALAPVFRITLPVLAPEVDSRTPWRELQLHDWMSEEYADLRDPFLKLSGFPCSWTFFHHLREQIRREFTLHDHLREEAQSVLGQLRLGRTGDRPRTFVGVHVRRGDYLQVMPQRWKGVVGDSAYLRQAMDWFRARHEAPVFVVTSNGMEWCKENIDTSQGDVTFAGDGQEATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFLKIFKPEAAFLPEWVGINADLSPLWTLAKP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FUT1 fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group) [ Homo sapiens ]
Official Symbol FUT1
Synonyms FUT1; fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group); fucosyltransferase 1 (galactoside 2 alpha L fucosyltransferase), fucosyltransferase 1 (galactoside 2 alpha L fucosyltransferase, Bombay phenotype included), H, HSC; galactoside 2-alpha-L-fucosyltransferase 1; alpha(1,2)FT 1; 2-alpha-L-fucosyltransferase; alpha (1,2) fucosyltransferase; blood group H alpha 2-fucosyltransferase; GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1; fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase); H; HH; HSC;
Gene ID 2523
mRNA Refseq NM_000148
Protein Refseq NP_000139
MIM 211100
UniProt ID P19526

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FUT1 Products

Required fields are marked with *

My Review for All FUT1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon