Recombinant Full Length Schizosaccharomyces Pombe Uncharacterized Protein C14C4.10C (Spac14C4.10C) Protein, His-Tagged
Cat.No. : | RFL15349SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Uncharacterized protein C14C4.10c (SPAC14C4.10c) Protein (O13717) (1-329aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-329) |
Form : | Lyophilized powder |
AA Sequence : | MELELDLLTGLQLLSEYCPRVTPNAPPRRASVAVIIAFKESQDFSNPKWPQCIPITSVPY VLLIQRSFRDTDRWSGHMALPGGTRSLTDKSDIQTAHRETLEEVGIDLRKEHAHFVGALD ERVITSNWGQFPLLLLSSFVFILPYMPSLRLQESEVFSAQWYPLADLLLPECQTRIQIDS SRALKKTYPRFIKTLFHLAVGNLMYSAIRLEFDPSSATYSLPPYQRPFLRGITHSIFVDL FIFLSPSSARHCLCWSLPYFQHYDLRFIASFFTQFYRLRLHQVYPRGNWVFTCLNGYYPY LKLTLLVGFLFRLFLVYLLFLIISAYYKS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SPAC14C4.10c |
Synonyms | SPAC14C4.10c; Uncharacterized protein C14C4.10c |
UniProt ID | O13717 |
◆ Recombinant Proteins | ||
DUSP22B-2493Z | Recombinant Zebrafish DUSP22B | +Inquiry |
RFL2166SF | Recombinant Full Length Saccharomyces Cerevisiae Delta(14)-Sterol Reductase Protein, His-Tagged | +Inquiry |
GUCA1B-4484H | Recombinant Human GUCA1B Protein, GST-tagged | +Inquiry |
ITGB1-4899P | Recombinant Pig ITGB1 protein, His&Myc-tagged | +Inquiry |
Prkg2-5126M | Recombinant Mouse Prkg2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
FN1-701H | Native Human Fibronectin 1 | +Inquiry |
IgA-130H | Native Human Immunoglobulin A | +Inquiry |
FGG-7H | Native Human Fibrinogen, FITC Labeled | +Inquiry |
FGG -41B | Native Bovine Fibrinogen, FITC Labeled | +Inquiry |
F9-26523TH | Native Human F9 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF148-141HCL | Recombinant Human ZNF148 293 Cell Lysate | +Inquiry |
KIAA0319L-900HCL | Recombinant Human KIAA0319L cell lysate | +Inquiry |
Jurkat-256H | Human Jurkat Membrane Lysate | +Inquiry |
PRDX5-2879HCL | Recombinant Human PRDX5 293 Cell Lysate | +Inquiry |
TMEM133-1005HCL | Recombinant Human TMEM133 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All SPAC14C4.10c Products
Required fields are marked with *
My Review for All SPAC14C4.10c Products
Required fields are marked with *
0
Inquiry Basket