Recombinant Human GUCA1B Protein, GST-tagged

• Cat.No.: GUCA1B-4484H
• Product Overview: Human GUCA1B partial ORF ( NP_002089, 93 a.a. - 200 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a calcium-binding protein that activates photoreceptor guanylate cyclases. This gene may have arisen due to a gene duplication event since there is a highly similar gene clustered with it on chromosome 6. Mutations in this gene can cause a form of retinitis pigmentosa. [provided by RefSeq, Nov 2009]
• Molecular Mass: 37.62 kDa
• AA Sequence: KLKWTFKIYDKDGNGCIDRLELLNIVEGIYQLKKACRRELQTEQDQLLTPEEVVDRIFLLVDENGDGQLSLNEFVEGARRDKWVMKMLQMDMNPSSWLAQQRRKSAMF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GUCA1B guanylate cyclase activator 1B (retina) [ Homo sapiens ]
• Official Symbol: GUCA1B
• Synonyms: GUCA1B; guanylate cyclase activator 1B (retina); guanylyl cyclase-activating protein 2; GCAP2; GCAP 2; guanylate cyclase-activating protein, photoreceptor 2; RP48; GUCA2; DKFZp686E1183
• Gene ID: 2979
• mRNA Refseq: NM_002098
• Protein Refseq: NP_002089
• MIM: 602275
• UniProt ID: Q9UMX6