Recombinant Full Length Saccharomyces Cerevisiae Delta(14)-Sterol Reductase Protein, His-Tagged
Cat.No. : | RFL2166SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Delta(14)-sterol reductase Protein (P32462) (1-438aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-438) |
Form : | Lyophilized powder |
AA Sequence : | MVSALNPRTTEFEFGGLIGALGISIGLPVFTIILNQMIRPDYFIKGFFQNFDIVELWNGI KPLRYYLGNRELWTVYCLWYGILAVLDVILPGRVMKGVQLRDGSKLSYKINGIAMSTTLV LVLAIRWKLTDGQLPELQYLYENHVSLCIISILFSFFLATYCYVASFIPLIFKKNGNGKR EKILALGGNSGNIIYDWFIGRELNPRLGPLDIKMFSELRPGMLLWLLINLSCLHHHYLKT GKINDALVLVNFLQGFYIFDGVLNEEGVLTMMDITTDGFGFMLAFGDLSLVPFTYSLQAR YLSVSPVELGWVKVVGILAIMFLGFHIFHSANKQKSEFRQGKLENLKSIQTKRGTKLLCD GWWAKSQHINYFGDWLISLSWCLATWFQTPLTYYYSLYFATLLLHRQQRDEHKCRLKYGE NWEEYERKVPYKIIPYVY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ERG24 |
Synonyms | ERG24; YNL280C; N0593; Delta(14-sterol reductase; C-14 sterol reductase; Sterol C14-reductase |
UniProt ID | P32462 |
◆ Native Proteins | ||
ctxB-01V | Native Vibrio cholerae ctxB Protein | +Inquiry |
Protease-20S | Active Native Streptomyces griseus Protease | +Inquiry |
DIS-2019 | Active Alpha-Cyclomaltodextrin glucanotransferase | +Inquiry |
IgG-019R | Native Rat Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
HSV-2ag-268V | Active Native HSV-2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TXK-713HCL | Recombinant Human TXK lysate | +Inquiry |
PHF3-3227HCL | Recombinant Human PHF3 293 Cell Lysate | +Inquiry |
EPX-6573HCL | Recombinant Human EPX 293 Cell Lysate | +Inquiry |
ZMYND19-148HCL | Recombinant Human ZMYND19 293 Cell Lysate | +Inquiry |
FAM86C-6340HCL | Recombinant Human FAM86C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ERG24 Products
Required fields are marked with *
My Review for All ERG24 Products
Required fields are marked with *
0
Inquiry Basket