Recombinant Full Length Schizosaccharomyces Pombe Uncharacterized Membrane Protein C6F6.13C(Spac607.08C) Protein, His-Tagged
Cat.No. : | RFL14705SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Uncharacterized membrane protein C6F6.13c(SPAC607.08c) Protein (Q9US10) (1-579aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-579) |
Form : | Lyophilized powder |
AA Sequence : | MAEQKIISLFDDDACTRYTILIASTIGEMREKKESIIDNTDPEIVKYLSQLLDVFRENFD TWAMAVVNRTGCALDPSTPKDQVEVKKFRQFSETEKSECFIKCLLLLILSLGNYSPYSRN LLYSIAEKLGLSSIVVYKAELITSSMLLDTFQTMESNQEMYELSGTRKMRRRIAMGLAGL AGGALIGLTGGLAAPFVAAGLGTLFAGLGLGTMIGATYLGTLITSAPMITALFGGFGAKM SMQQMGDVSKGLTDFEFIPLSVQSHLPVTIGISGWLGDYNEVDAAWKSLTVGDKSYYWGD IYALKFEVEALVDLGKSLSRILFSAGLGWVKGEVISRTILAPLAAALWPLSLLKVGNILG NSWRIAFNLSIKAGEALANALCVRAQGMRPVTLIGFSLGARTILECLLHLADRGETNLVE NVIVMGAPMPTDAKLWLKMRCVVAGRFVNVYSASDYVLQLVYRVNSAQSTAAGLGPVSLD SNTLENVDVGDLVEGHLQYRWLVAKILKERLGYDNISDAEIQSLAVQEEKYESKQRTYYS QKEQEEEIEQEVLFDASSDTELAIQKKEDEVNEVRENKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SPAC607.08c |
Synonyms | SPAC607.08c; Uncharacterized membrane protein C6F6.13c |
UniProt ID | Q9US10 |
◆ Recombinant Proteins | ||
RFL16208PF | Recombinant Full Length Prochlorococcus Marinus Subsp. Pastoris Photosystem Ii Reaction Center Protein J(Psbj) Protein, His-Tagged | +Inquiry |
TRAF3-4611H | Recombinant Human TRAF3 protein | +Inquiry |
GPR82-5270H | Recombinant Human GPR82 Protein, GST-tagged | +Inquiry |
RPLF-1649S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 RPLF protein, His-tagged | +Inquiry |
FGD2-5832M | Recombinant Mouse FGD2 Protein | +Inquiry |
◆ Native Proteins | ||
Lectin-1728L | Active Native Lycopersicon Esculentum Lectin Protein, Texas Red conjugated | +Inquiry |
Glycogen-016B | Native bovine liver Glycogen | +Inquiry |
LOC780933-1B | Native Bovine Anhydrotrypsin | +Inquiry |
LPA-8453H | Native Human LPA | +Inquiry |
Collagen Type I-03R | Native Rat Collagen Type I (Atelocollagen) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMMR-5469HCL | Recombinant Human HMMR 293 Cell Lysate | +Inquiry |
TBCEL-1215HCL | Recombinant Human TBCEL 293 Cell Lysate | +Inquiry |
TIMM23-1067HCL | Recombinant Human TIMM23 293 Cell Lysate | +Inquiry |
TBL2-1212HCL | Recombinant Human TBL2 293 Cell Lysate | +Inquiry |
PLA2G3-3142HCL | Recombinant Human PLA2G3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPAC607.08c Products
Required fields are marked with *
My Review for All SPAC607.08c Products
Required fields are marked with *
0
Inquiry Basket