Recombinant Human GPR82 Protein, GST-tagged

• Cat.No.: GPR82-5270H
• Product Overview: Human GPR82 partial ORF (NP_543007.1, 237 a.a. - 336 a.a.) recombinant protein with GST tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 237-336 a.a.
• Description: G protein-coupled receptors (GPCRs, or GPRs) contain 7 transmembrane domains and transduce extracellular signals through heterotrimeric G proteins.[supplied by OMIM
• Molecular Mass: 36.63 kDa
• AA Sequence: IMEKDLTYSSVKRHLLVIQILLIVCFLPYSIFKPIFYVLHQRDNCQQLNYLIETKNILTCLASARSSTDPIIFLLLDKTFKKTLYNLFTKSNSAHMQSYG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GPR82 G protein-coupled receptor 82 [ Homo sapiens ]
• Official Symbol: GPR82
• Synonyms: GPR82; G protein-coupled receptor 82; probable G-protein coupled receptor 82
• Gene ID: 27197
• mRNA Refseq: NM_080817
• Protein Refseq: NP_543007
• MIM: 300748
• UniProt ID: Q96P67