Recombinant Full Length Schizosaccharomyces Pombe Synembryn-Like Protein C3E7.04C (Spbc3E7.04C) Protein, His-Tagged
Cat.No. : | RFL8647SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Synembryn-like protein C3E7.04c (SPBC3E7.04c) Protein (G2TRT0) (1-530aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-530) |
Form : | Lyophilized powder |
AA Sequence : | MELEAYIQSLGLGIESYSQSATQFHDEANQSFNIPISTIIKLKEACRELETSKVVAKSLN WSHLLRVISLLWEKDVSLELMKLLANCLRQVPSISVQIVHNESLKQLTTSVFEVRAPKVL SLISTFNDDLERRVVFMRFLFILLSTQTDDICLDMRQVRTQLIQMLKKMWTLNSSPSNNS QDNEMVLTEILRLLFPISKRSYLKEEDEQKILLLVIEIWASSLNNNPNSPLRWHATNALL SFNLQLLSLDQAIYVSEIACQTLQSILISREVEYLEKGLNLCFDIAAKYQNTLPPILAIL LSLLSFFNIKQNLSMLLFPTNDDRKQSLQKGKSFRCLLLRLLTIPIVEPIGTYYASLLNE LCDGDSQQIARIFGAGYAMGISQHSETMPFPSPLSKAASPVFQKNSRGQENTEENNLAID PITGSMCTNRNKSQRLELSQEEKEREAERLFYLFQRLEKNSTIQVTNPIQQAVNSGFIDV VFCLIFQMSSESFIYHCYHSFVGPIHILLLMFSTFKFHEILHFIKISKAS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SPBC3E7.04c |
Synonyms | SPBC3E7.04c; Synembryn-like protein C3E7.04c |
UniProt ID | G2TRT0 |
◆ Recombinant Proteins | ||
LRRC15-4015H | Recombinant Human LRRC15 Protein(Met1-Gly538), His-tagged | +Inquiry |
ESR1-18H | Recombinant Human ESR1 Protein, His-tagged | +Inquiry |
MAPKAP1-1280HFL | Recombinant Full Length Human MAPKAP1 Protein, C-Flag-tagged | +Inquiry |
MRGA-0722B | Recombinant Bacillus subtilis MRGA protein, His-tagged | +Inquiry |
KREMEN2-0314R | Recombinant Rat KREMEN2 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Y. enterocolitica-30 | Native Yersinia enterocolitica O:8 Antigen | +Inquiry |
APOC3-27333TH | Native Human APOC3 | +Inquiry |
Lectin-1777G | Active Native Galanthus Nivalis Lectin Protein, Biotinylated | +Inquiry |
COL2A1-14B | Native Bovine COL2A1 Protein | +Inquiry |
APOC2-4904H | Native Human Apolipoprotein CII | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADD2-9015HCL | Recombinant Human ADD2 293 Cell Lysate | +Inquiry |
IL17RD-2919HCL | Recombinant Human IL17RD cell lysate | +Inquiry |
CD300A-1809MCL | Recombinant Mouse CD300A cell lysate | +Inquiry |
TGIF1-1116HCL | Recombinant Human TGIF1 293 Cell Lysate | +Inquiry |
THAP11-1771HCL | Recombinant Human THAP11 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPBC3E7.04c Products
Required fields are marked with *
My Review for All SPBC3E7.04c Products
Required fields are marked with *
0
Inquiry Basket