Recombinant Full Length Human MAPKAP1 Protein, C-Flag-tagged
Cat.No. : | MAPKAP1-1280HFL |
Product Overview : | Recombinant Full Length Human MAPKAP1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a protein that is highly similar to the yeast SIN1 protein, a stress-activated protein kinase. Alternatively spliced transcript variants encoding distinct isoforms have been described. Alternate polyadenylation sites as well as alternate 3' UTRs have been identified for transcripts of this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 58.9 kDa |
AA Sequence : | MAFLDNPTIILAHIRQSHVTSDDTGMCEMVLIDHDVDLEKIHPPSMPGDSGSEIQGSNGETQGYVYAQSV DITSSWDFGIRRRSNTAQRLERLRKERQNQIKCKNIQWKERNSKQSAQELKSLFEKKSLKEKPPISGKQS ILSVRLEQCPLQLNNPFNEYSKFDGKGHVGTTATKKIDVYLPLHSSQDRLLPMTVVTMASARVQDLIGLI CWQYTSEGREPKLNDNVSAYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVEKYSSPGLTSKESLF VRINAAHGFSLIQVDNTKVTMKEILLKAVKRRKGSQKVSGPQYRLEKQSEPNVAVDLDSTLESQSAWEFC LVRENSSRADGVFEEDSQIDIATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKAS TKFWIKQKPISIDSDLLCACDLAEEKSPSHAIFKLTYLSNHDYKHLYFESDAATVNEIVLKVNYILESRA STARADYFAQKQRKLNRRTSFSFQKEKKSGQQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | MAPKAP1 MAPK associated protein 1 [ Homo sapiens (human) ] |
Official Symbol | MAPKAP1 |
Synonyms | MIP1; SIN1; JC310; SIN1b; SIN1g |
Gene ID | 79109 |
mRNA Refseq | NM_001006617.3 |
Protein Refseq | NP_001006618.1 |
MIM | 610558 |
UniProt ID | Q9BPZ7 |
◆ Recombinant Proteins | ||
MAPKAP1-5355M | Recombinant Mouse MAPKAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MAPKAP1-1797H | Recombinant Human MAPKAP1 Protein (2-522 aa), His-SUMO-tagged | +Inquiry |
MAPKAP1-3577R | Recombinant Rat MAPKAP1 Protein | +Inquiry |
MAPKAP1-1365H | Recombinant Human MAPKAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MAPKAP1-29583TH | Recombinant Human MAPKAP1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAPKAP1-4484HCL | Recombinant Human MAPKAP1 293 Cell Lysate | +Inquiry |
MAPKAP1-4483HCL | Recombinant Human MAPKAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MAPKAP1 Products
Required fields are marked with *
My Review for All MAPKAP1 Products
Required fields are marked with *
0
Inquiry Basket