Recombinant Full Length Schizosaccharomyces Pombe Pheromone M-Factor Receptor(Map3) Protein, His-Tagged
Cat.No. : | RFL13460SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Pheromone M-factor receptor(map3) Protein (P31397) (1-365aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-365) |
Form : | Lyophilized powder |
AA Sequence : | MLPIGIFYQFYAYFALVLSIPILYMQLRARNIPCLLLLFWLTLTTLIYVVESAIWSNPYA ETIRWMGYGLCDITSRIVTCSSIGIPASAFTLVLYLDTVIRRDHPLKRYENWIWHVCLSI LLPLIIMAMMVPLESNRYVVICMNGCYSSFYQTWYTLLFFYIPPCLLSFGGLFFVSRIVV LYWRRQRELQQFFQRDSQLTSKRFLRLLCLAAVFFLGYFPLTIFMVVANGKLQQFLPFNH ELVEAWHQESITYYPTTKVGLNDWVPPTVLYLMSLFFSTSGGWTEKVALILWSLLVWLPF TKNTALGRHAQFKLDCCKSIESTMAGKTLDSTDFKEKCLVLERQWSKSSIPSDNSSELQD AAKYV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | map3 |
Synonyms | map3; SPAC3F10.10c; Pheromone M-factor receptor |
UniProt ID | P31397 |
◆ Recombinant Proteins | ||
ANKRD37-1309HF | Recombinant Full Length Human ANKRD37 Protein, GST-tagged | +Inquiry |
CCDC6-2883C | Recombinant Chicken CCDC6 | +Inquiry |
UNG-1019HFL | Recombinant Full Length Human UNG Protein, C-Flag-tagged | +Inquiry |
Snap23-5991M | Recombinant Mouse Snap23 Protein, Myc/DDK-tagged | +Inquiry |
Ccl9-209R | Recombinant Rat Ccl9 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
GC-198H | Native Human GC-Globulin | +Inquiry |
IgG-7438M | Native Mouse IgG Fc Protein, Biotin conjugated | +Inquiry |
LDL-393H | Native Human Low Density Lipoprotein | +Inquiry |
Lectin-1797L | Active Native Lotus Tetragonolobus Lectin Protein, Biotinylated | +Inquiry |
MARCKS-12B | Native Bovine MARCKS protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM3D-806MCL | Recombinant Mouse FAM3D cell lysate | +Inquiry |
PRMT8-2837HCL | Recombinant Human PRMT8 293 Cell Lysate | +Inquiry |
TCP10L-1167HCL | Recombinant Human TCP10L 293 Cell Lysate | +Inquiry |
SYNGR4-1316HCL | Recombinant Human SYNGR4 293 Cell Lysate | +Inquiry |
CASQ2-7826HCL | Recombinant Human CASQ2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All map3 Products
Required fields are marked with *
My Review for All map3 Products
Required fields are marked with *
0
Inquiry Basket