Recombinant Full Length Salmonella Heidelberg Arginine Exporter Protein Argo(Argo) Protein, His-Tagged
Cat.No. : | RFL10709SF |
Product Overview : | Recombinant Full Length Salmonella heidelberg Arginine exporter protein ArgO(argO) Protein (B4THE9) (1-211aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella Heidelberg |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-211) |
Form : | Lyophilized powder |
AA Sequence : | MISYYFQGFALGAAMILPLGPQNAFVMNQGIRRQYHLMIALLCALSDLVLISAGIFGGSA LLMQSPWLLALVTWGGVAFLLWYGFGALKTAMSSNLELASAEVMKQGRWKIIATMLAVTW LNPHVYLDTFVVLGSLGGQLAMEPKRWFALGTISASFLWFFGLALLAAWLAPRLRTAKAQ RIINILVGVVMWLIAFQLAREGVAHMHALFN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | argO |
Synonyms | argO; SeHA_C3302; Arginine exporter protein ArgO |
UniProt ID | B4THE9 |
◆ Recombinant Proteins | ||
Kif9-1271M | Recombinant Mouse Kif9 Protein, MYC/DDK-tagged | +Inquiry |
UCN-6076R | Recombinant Rat UCN Protein, His (Fc)-Avi-tagged | +Inquiry |
PTGER2-4807R | Recombinant Rat PTGER2 Protein | +Inquiry |
CRABP2-1893H | Recombinant Human CRABP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
YOPD-3737B | Recombinant Bacillus subtilis YOPD protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
ADVag-281V | Active Native ADV Protein | +Inquiry |
CA2-31M | Native Mouse Carbonic Anhydrase II (CA2) Protein | +Inquiry |
APOE-5336H | Native Human Apolipoprotein E | +Inquiry |
Thrombin-26H | Active Native Human-Thrombin | +Inquiry |
GSN-874P | Active Native Porcine GSN Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALKBH3-8901HCL | Recombinant Human ALKBH3 293 Cell Lysate | +Inquiry |
PVR-2996MCL | Recombinant Mouse PVR cell lysate | +Inquiry |
NAPB-430HCL | Recombinant Human NAPB lysate | +Inquiry |
K562-01HL | Human K562 lysate | +Inquiry |
Cerebral Meninges-75R | Rhesus monkey Cerebral Meninges Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All argO Products
Required fields are marked with *
My Review for All argO Products
Required fields are marked with *
0
Inquiry Basket