Recombinant Human CRABP2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CRABP2-1893H
• Product Overview: CRABP2 MS Standard C13 and N15-labeled recombinant protein (NP_001869) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a member of the retinoic acid (RA, a form of vitamin A) binding protein family and lipocalin/cytosolic fatty-acid binding protein family. The protein is a cytosol-to-nuclear shuttling protein, which facilitates RA binding to its cognate receptor complex and transfer to the nucleus. It is involved in the retinoid signaling pathway, and is associated with increased circulating low-density lipoprotein cholesterol. Alternatively spliced transcript variants encoding the same protein have been found for this gene.
• Molecular Mass: 15.7 kDa
• AA Sequence: MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CRABP2 cellular retinoic acid binding protein 2 [ Homo sapiens (human) ]
• Official Symbol: CRABP2
• Synonyms: CRABP2; cellular retinoic acid binding protein 2; cellular retinoic acid-binding protein 2; CRABP II; cellular retinoic acid-binding protein II; RBP6; CRABP-II
• Gene ID: 1382
• mRNA Refseq: NM_001878
• Protein Refseq: NP_001869
• MIM: 180231
• UniProt ID: P29373