Recombinant Full Length Saccharomyces Cerevisiae Uncharacterized Protein Ykl047W (Ykl047W) Protein, His-Tagged
Cat.No. : | RFL29932SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Uncharacterized protein YKL047W (YKL047W) Protein (P36090) (1-516aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-516) |
Form : | Lyophilized powder |
AA Sequence : | MNSGGEEPTIKPNVFNITQLLNSNGEKPGIACIFLSKFDMKKGNIIIWSKSINGAAIDLS NIEFKSLPAGIHEQTDDVVNFVVPKELDVCQTAKTTTYDYGIAYFKQNSFDIIENDNRID RSKVQMFSLGVIIDVQNASSDSKKHFYKEIYHAYAANRYSSYLESLLGQWIRQRDLDKFD IFEKFFDENNQGHMAENSVEVFEHSPKERRHLVEYLPYWTRKLGPLIFPLWKASLLQSRI LILVPQGESFELCNSLAYCVFLISMLPKNLIGNHVSDEYIKPIFTVSTSDIPFLESFKKG NGYVATTSEEILLYKPEIYDIVVKLTSSSTIEESPEKEVEILTASGEQNKATPLDLEVYE KLILGELQEDASTNATCRHHEVTEPISWLQFLIDGFFLLTTAGYLVAPYHLANNFKIPRH VSGPEPNNSEIQIAENLVRYFHRRTSNLYNDLKDVIQKSENIDSEQPITIAASFLTKLNL DCFSKQDHQFVKDIALKWFQRSIDISNLPECLGNLC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ANR2 |
Synonyms | ANR2; YKL047W; YKL260; Uncharacterized protein ANR2; AVL9-related family protein 2 |
UniProt ID | P36090 |
◆ Recombinant Proteins | ||
RFL20033EF | Recombinant Full Length Photosystem Ii D2 Protein(Psbd) Protein, His-Tagged | +Inquiry |
NP-634V | Recombinant H7N9 (A/Anhui/1-BALF_RG6/2013) NP Protein, His-tagged | +Inquiry |
ATG5-020H | Recombinant Human ATG5 Protein, His-tagged | +Inquiry |
PRSS21-2630H | Recombinant Human PRSS21 Protein, His-tagged | +Inquiry |
CTSK-6530C | Recombinant Chicken CTSK | +Inquiry |
◆ Native Proteins | ||
Saporin-30S | Native Saponaria officinalis ribosome-inactivating Protein | +Inquiry |
PLD-18A | Active Native Arachis hypogaea (peanut) Phospholipase D, Type II | +Inquiry |
Complement C1-42H | Native Human Complement C1 | +Inquiry |
Lectin-1834R | Active Native Ricinus Communis Agglutinin II Protein | +Inquiry |
PLG-30880TH | Native Human PLG | +Inquiry |
◆ Cell & Tissue Lysates | ||
STX1A-1717HCL | Recombinant Human STX1A cell lysate | +Inquiry |
GSK3B-717HCL | Recombinant Human GSK3B cell lysate | +Inquiry |
TMED6-1023HCL | Recombinant Human TMED6 293 Cell Lysate | +Inquiry |
Cerebral Cortex-71R | Rhesus monkey Cerebral Cortex Lysate | +Inquiry |
K-562-887H | K-562 (human chronic myelogenous leukemia) nuclear extract lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANR2 Products
Required fields are marked with *
My Review for All ANR2 Products
Required fields are marked with *
0
Inquiry Basket