Recombinant Full Length Saccharomyces Cerevisiae Nuclear Rim Protein 1(Nur1) Protein, His-Tagged
Cat.No. : | RFL16066SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Nuclear rim protein 1(NUR1) Protein (A6ZXN8) (1-484aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-484) |
Form : | Lyophilized powder |
AA Sequence : | MGSNDLINEAYDDSEVVGEERESKSAWMKRWYQLLTSPLDLQLVINEKLEMINWDAYAKS LAKPLGNFLTILFFIIRLLQDNLIKPNYYKLNVKSGAFDLSKSNKLKEFDYLWEISSSFQ NSNQFYAFQSWYFVTLRFLNNLFRFTIFILLSLNLYVSCKFMFGYFKTYNLFHLKKEFNS PNLTKHNLKDLSKEYYEDIYKQSLWSMLKHFFRGSRDDGPHVNQNEVEIFFQLRKWIPTN FMINLFVSFSPTAIVFLSFSDVSFTSAIAIVFHQYILDYIITKRFQRSVDDDLILSSAAL QEYEDKHIMARINQCSNIDTLSSAMGTRSKTPRIFTTHSLCGEEIREVYNYEKREFEALP KMTESVPGSRETRIKDYGGISQVSDNQSHPIGFHYSPRMSPYYRDKVLDNNLAQSSSNEN LEKGGAFLPNQDQNRPSKSLSPLRKTPLSARQKRFEGSEFNVLNKNDINSILRSPKKKKN YHKR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NUR1 |
Synonyms | NUR1; SCY_0826; Nuclear rim protein 1 |
UniProt ID | A6ZXN8 |
◆ Recombinant Proteins | ||
RELN-8062H | Recombinant Human RELN protein, His & T7-tagged | +Inquiry |
HGS-2238H | Recombinant Human HGS Protein, His-tagged | +Inquiry |
Pdcd1-823MAF647 | Recombinant Mouse Pdcd1 Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
PTMS-13662M | Recombinant Mouse PTMS Protein | +Inquiry |
RFL20065IF | Recombinant Full Length Ignicoccus Hospitalis Major Outer Membrane Protein 1(Ihomp1) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Collagen Type I-03R | Native Rat Collagen Type I (Atelocollagen) Protein | +Inquiry |
MPO-01H | Active Native Human MPO Protein | +Inquiry |
BCC-162B | Native Bovine Cholesterol Concentrate | +Inquiry |
Lectin-1828P | Active Native Pisum Sativum Agglutinin Protein, Biotinylated | +Inquiry |
CTSG-1649H | Active Native Human CTSG protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MS4A6A-4121HCL | Recombinant Human MS4A6A 293 Cell Lysate | +Inquiry |
VAX1-421HCL | Recombinant Human VAX1 293 Cell Lysate | +Inquiry |
GGACT-1HCL | Recombinant Human GGACT lysate | +Inquiry |
FAM118B-6445HCL | Recombinant Human FAM118B 293 Cell Lysate | +Inquiry |
SLCO4A1-1685HCL | Recombinant Human SLCO4A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All NUR1 Products
Required fields are marked with *
My Review for All NUR1 Products
Required fields are marked with *
0
Inquiry Basket