Recombinant Full Length Saccharomyces Cerevisiae Monopolar Spindle Protein 2(Mps2) Protein, His-Tagged
Cat.No. : | RFL5025SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Monopolar spindle protein 2(MPS2) Protein (E7QET1) (1-387aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-387) |
Form : | Lyophilized powder |
AA Sequence : | MSNGAFDAIFEYAWGQIDKPISGDFIYGKDLPKLIEIIENIFQKAQKSGSYELRLPLFSE INKDLFRTFSNTKTFFKIHKEEFDDIFFNLVNHPLREILENAFIGVDSIPSDFIVSMNLN SPSKFLVENKSKNTEGAGISTPRKKLTESPIKLLSRNNIGKALEVQVEELKRELTAKQSL LQENERQVSELKIRLETYQEKYASIQQRFSDLQKARQVEDNQNSSRTSDPGSPLVTGIDQ KAILEEFRRRLQRQTDTISFLKDQIRRERGLNCSNDKVSHSKRKHATTDGDGTFKNFISA VPSNIWVKATIRIIVCFALLAGVLPYIRKYVYAHDTPSQNSRLQLSWWENSGILSKIVWF FEDQTDLETEYRSNANVDDAYSRVFGI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MPS2 |
Synonyms | MPS2; MMC1; VL3_1713; Monopolar spindle protein 2 |
UniProt ID | E7QET1 |
◆ Recombinant Proteins | ||
BTBD11-1658HF | Recombinant Full Length Human BTBD11 Protein, GST-tagged | +Inquiry |
NAF1-3890R | Recombinant Rat NAF1 Protein | +Inquiry |
GFRA3-181M | Recombinant Mouse Gfra3, His tagged | +Inquiry |
PARK7-2549H | Recombinant Human PARK7 Protein, His-tagged | +Inquiry |
CSF2RA-2167HF | Recombinant Full Length Human CSF2RA Protein | +Inquiry |
◆ Native Proteins | ||
CA-242-380H | Active Native Human Cancer Antigen 242 | +Inquiry |
APOA2-4772H | Native Human Apolipoprotein AII protein | +Inquiry |
Complement C3d-48H | Native Human Complement C3d | +Inquiry |
LOC102577615-62P | Native potato LOC102577615 Protein | +Inquiry |
Egf -634M | Active Native Mouse Egf protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GALR3-6027HCL | Recombinant Human GALR3 293 Cell Lysate | +Inquiry |
PLA2G2A-2184HCL | Recombinant Human PLA2G2A cell lysate | +Inquiry |
SEPT3-1962HCL | Recombinant Human SEPT3 293 Cell Lysate | +Inquiry |
Thymus-734P | Pig Thymus Lysate, Total Protein | +Inquiry |
ARFGAP3-8753HCL | Recombinant Human ARFGAP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MPS2 Products
Required fields are marked with *
My Review for All MPS2 Products
Required fields are marked with *
0
Inquiry Basket