Recombinant Full Length Saccharomyces Cerevisiae Monopolar Spindle Protein 2(Mps2) Protein, His-Tagged
Cat.No. : | RFL35665SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Monopolar spindle protein 2(MPS2) Protein (B3LHE1) (1-387aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-387) |
Form : | Lyophilized powder |
AA Sequence : | MSNGAFDAIFEYAWGQIDKPISGDFIYGKDLPKLIEIIENIFQKAQKSGSYELRLPLFSE INKDLFRTFSNTKTFFKIHKEEFDDIFFNLVNHPLREILENAFIGVDSIPSDFIVSMNLN SPSKFLVENKSKNTEGAGISTSRKKLTESPIKLLSRNNIGKALEVQVEELKRELTAKQSL LQENERQVSELKIRLETYQEKYASIQQRFSDLQKARQVEDNQNSSRTSDPGSPLVTGIDQ KAILEEFRRRLQRQTDTISFLKDQIRRERGLNCSNDKVSHSKRKHATTDGDGTFKNFISA VPSNIWVKATIRIIVCFALLAGVLPYIRKYVYAHDTPSQNSRLQLSWWENSGILSKIVWF FEDQTDLETEYRSNANVDDAYSRVFGI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MPS2 |
Synonyms | MPS2; MMC1; SCRG_01074; Monopolar spindle protein 2 |
UniProt ID | B3LHE1 |
◆ Recombinant Proteins | ||
OAZ2-3899C | Recombinant Chicken OAZ2 | +Inquiry |
RFL28554HF | Recombinant Full Length Human Frizzled-2(Fzd2) Protein, His-Tagged | +Inquiry |
LINC00982-4912HF | Recombinant Full Length Human LINC00982 Protein, GST-tagged | +Inquiry |
DTYMK-3479Z | Recombinant Zebrafish DTYMK | +Inquiry |
CD209-0919H | Recombinant Human CD209 Protein (Glu70-Ala404), N-His tagged | +Inquiry |
◆ Native Proteins | ||
S100B-256B | Native Bovine S-100 Protein | +Inquiry |
Lectin-1853U | Active Native Ulex Europaeus Agglutinin I Protein, Fluorescein labeled | +Inquiry |
DIS-2020 | Active Cyclodextrin Glucanotransferase (Powder) | +Inquiry |
IgY-006D | Native Duck IgY | +Inquiry |
vip3A-38B | Native Bacillus thuringiensis vip3A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPL8-2187HCL | Recombinant Human RPL8 293 Cell Lysate | +Inquiry |
CHERP-7541HCL | Recombinant Human CHERP 293 Cell Lysate | +Inquiry |
SH3BGRL2-594HCL | Recombinant Human SH3BGRL2 lysate | +Inquiry |
RAC3-2566HCL | Recombinant Human RAC3 293 Cell Lysate | +Inquiry |
TTC9B-1858HCL | Recombinant Human TTC9B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MPS2 Products
Required fields are marked with *
My Review for All MPS2 Products
Required fields are marked with *
0
Inquiry Basket