Recombinant Full Length Lachancea Thermotolerans Monopolar Spindle Protein 2(Mps2) Protein, His-Tagged
Cat.No. : | RFL1100LF |
Product Overview : | Recombinant Full Length Lachancea thermotolerans Monopolar spindle protein 2(MPS2) Protein (C5E2E7) (1-386aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Lachancea thermotolerans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-386) |
Form : | Lyophilized powder |
AA Sequence : | MDTERHATLLLDLVWPEVDEKAQGFIYAKDFPLVVSRMEEILNRGKLERDRAQLVSETGR EILRKFGSDQEFFKVYKEDFRELFDGLVGTSFKSAVKSCAGDGVLDRLQDSQAVDGIQDE KTSSHALQEEVMRLREQVRVLSSKNDEKDREITARDEIIADLQGKDASPAGSPRSLQRMR TLQARVTSLEDELSFRDEVIREKDRELLNLTKRVGEFKDKYQFLEREFQFYKGHREQKSP DSIKEATRHEFIISELRRKITEQSEIIGQMRMQVEAKPGALHPQGIGSTAGLPLNLPLRL VLRLIIGAILAYLAFDIGIRSLKAVGGLFGSSSPATLTPKSELSWWEQNTLLSKLLWFFK DLFDTYNLDAGRDEVVSANYDKLFGV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MPS2 |
Synonyms | MPS2; KLTH0H04312g; Monopolar spindle protein 2 |
UniProt ID | C5E2E7 |
◆ Native Proteins | ||
Lectin-1819P | Active Native Phaseolus Vulgaris Erythroagglutinin Protein, Biotinylated | +Inquiry |
Type II Collagen-01C | Native Chicken Type II Collagen | +Inquiry |
HBA2-27786TH | Native Human HBA2 | +Inquiry |
IGHE -22H | Native Human IgE | +Inquiry |
LDL-407H | Native Human Low Density Lipoprotein, Acetylated, DiI labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
LYG2-4596HCL | Recombinant Human LYG2 293 Cell Lysate | +Inquiry |
CDKN1B-7617HCL | Recombinant Human CDKN1B 293 Cell Lysate | +Inquiry |
NMBR-3794HCL | Recombinant Human NMBR 293 Cell Lysate | +Inquiry |
SCAMP2-2049HCL | Recombinant Human SCAMP2 293 Cell Lysate | +Inquiry |
IRF2-5167HCL | Recombinant Human IRF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All MPS2 Products
Required fields are marked with *
My Review for All MPS2 Products
Required fields are marked with *
0
Inquiry Basket