Recombinant Full Length Saccharomyces Cerevisiae Monopolar Spindle Protein 2(Mps2) Protein, His-Tagged
Cat.No. : | RFL8600SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Monopolar spindle protein 2(MPS2) Protein (E7NHN2) (1-387aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-387) |
Form : | Lyophilized powder |
AA Sequence : | MSNGAFDAIFEYAWGQIDKPISGDFIYGKDLPKLIEIIENIFQKAQKSGSYELRLPLFSE INKDLFRTFSNTKTFFKIHKEEFDDIFFNLVNHPLREILENAFIGVDSIPSDFIVSMNLN SPSKFLVENKNKNTEGAGISTPRKKLTESPIKLLSRXNIGKALEVQVEELKRELTAKQSL LQENERQVSELKIRLETYQEKYASIQQRFSDLQKARQVEDNQNSSRTSDPGSPLVTGIDQ KAILEEFRRRLQRQTDTISFLKDQIRRERGLNCSNDKVSHSKRKHATTDGDGTFKNFISA VPSNIWVKATIRIIVCFALLAGVLPYIRKYVYAHDTPSQNSRLQLSWWENSGILSKIVWF FEDQTDLETEYRSNANVDDAYSRVFGI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MPS2 |
Synonyms | MPS2; MMC1; FOSTERSO_1678; Monopolar spindle protein 2 |
UniProt ID | E7NHN2 |
◆ Recombinant Proteins | ||
BTLA-1148RAF647 | Active Recombinant Rat Btla Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
OTUD7A-6439M | Recombinant Mouse OTUD7A Protein, His (Fc)-Avi-tagged | +Inquiry |
AKR1C1-121R | Recombinant Rhesus Macaque AKR1C1 Protein, His (Fc)-Avi-tagged | +Inquiry |
WDR45L-3716H | Recombinant Human WDR45L, GST-tagged | +Inquiry |
RORC-4002H | Recombinant Human RORC Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
FSHB-81H | Active Native Human FSH | +Inquiry |
COLV-19B | Native Bovine COLV Protein | +Inquiry |
LDL-406H | Native Human Low Density Lipoprotein, Acetylated, Biotin labeled | +Inquiry |
Egf-634M | Active Native Mouse Egf | +Inquiry |
Testis-022H | Human Testis Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MSANTD4-4958HCL | Recombinant Human KIAA1826 293 Cell Lysate | +Inquiry |
RNF183-2286HCL | Recombinant Human RNF183 293 Cell Lysate | +Inquiry |
COX6B2-7328HCL | Recombinant Human COX6B2 293 Cell Lysate | +Inquiry |
PTER-2720HCL | Recombinant Human PTER 293 Cell Lysate | +Inquiry |
C1orf216-8165HCL | Recombinant Human C1orf216 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MPS2 Products
Required fields are marked with *
My Review for All MPS2 Products
Required fields are marked with *
0
Inquiry Basket