Recombinant Full Length Saccharomyces Cerevisiae Monopolar Spindle Protein 2(Mps2) Protein, His-Tagged
Cat.No. : | RFL28397SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Monopolar spindle protein 2(MPS2) Protein (C8Z8H2) (1-387aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-387) |
Form : | Lyophilized powder |
AA Sequence : | MSNGAFDAIFEYAWGQIDKPISGDFIYGKDLPKLIEIIENIFQKAQKSGSYELRLPLFSE INKDLFRTFSNTKTFFKIHKEEFDDIFFNLVNHPLREILENAFIGVDSIPSDFIVSMNLN SPSKFLVENKSKNTEGAGISTPRKKLTESPIKLLSRNNIGKALEVQVEELKRELTAKQSL LQENERQVSELKIRLETYQEKYASIQQRFSDLQKARQVEDNQNSSRTSDPGSPLVTGIDQ KAILEEFRRRLQRQTDTISFLKDQIRRERGLNCSNDKVSHSKRKHATTDGDGTFKNFISA VPSNIWVKATIRIIVCFALLAGVLPYIRKYVYAHDTPSQNSRLQLSWWENSGILSKIVWF FEDQTDLETEYRSNANVDDAYSRVFGI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MPS2 |
Synonyms | MPS2; MMC1; EC1118_1G1_2146g; Monopolar spindle protein 2 |
UniProt ID | C8Z8H2 |
◆ Recombinant Proteins | ||
Endochitinase-3794O | Recombinant Oat Endochitinase protein, His-tagged | +Inquiry |
RFL738MF | Recombinant Full Length Uncharacterized Protein Mb2352C (Mb2352C) Protein, His-Tagged | +Inquiry |
POTEJ-1641H | Recombinant Human POTEJ protein, His & S-tagged | +Inquiry |
NFIX-30379TH | Recombinant Human NFIX | +Inquiry |
Ipcef1-3562M | Recombinant Mouse Ipcef1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
F2-90B | Active Native Bovine Thrombin | +Inquiry |
TNNI1-49H | Native Human troponin I type 1 Protein | +Inquiry |
C-type lectin like protein-040H | Native Hen C-type lectin like protein Protein | +Inquiry |
Factor XIIIa-68H | Native Human Factor XIIIa protein | +Inquiry |
GG-186G | Native Goat Gamma Globulin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
VCAN-413HCL | Recombinant Human VCAN cell lysate | +Inquiry |
POLDIP3-3049HCL | Recombinant Human POLDIP3 293 Cell Lysate | +Inquiry |
IL18R1-837CCL | Recombinant Canine IL18R1 cell lysate | +Inquiry |
IL11RA-2558MCL | Recombinant Mouse IL11RA cell lysate | +Inquiry |
DU145-059WCY | Human Prostate Carcinoma DU145 Whole Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MPS2 Products
Required fields are marked with *
My Review for All MPS2 Products
Required fields are marked with *
0
Inquiry Basket