Recombinant Full Length Saccharomyces Cerevisiae Monopolar Spindle Protein 2(Mps2) Protein, His-Tagged
Cat.No. : | RFL25478SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Monopolar spindle protein 2(MPS2) Protein (E7KNG0) (1-387aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-387) |
Form : | Lyophilized powder |
AA Sequence : | MSNGAFDAIFEYAWGQIDKPISGDFIYGKDLPKLIEIIENIFQKAQKSGSYELRLPLFSE INKDLFRTFSNTKTFFKIHKEEFDDIFFNLVNHPLREILENAFIGVDSIPSDFIVSMNLN SPSKFLVENKSKNTEGAGISTPRKKLTESPIKLLSRNNIGKALEVQVEELKRELTAKQSL LQENERQVSELKIRLETYQEKYASIQQRFSDLQKARQVEDNQNSSRTSDPGSPLVTGIDQ KAILEEFRRRLQRQTDTISFLKDQIRRERGLNCSNDKVSHSKRKHATTDGDGTFKNFISA VPSNIWVKATIRIIVCFALLAGVLPYIRKYVYAHDTPSQNSRLQLSWWENSGILSKIVWF FEDQTDLETEYRSNANVDDAYSRVFGI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MPS2 |
Synonyms | MPS2; MMC1; QA23_1714; Monopolar spindle protein 2 |
UniProt ID | E7KNG0 |
◆ Recombinant Proteins | ||
GOLGA5-2616R | Recombinant Rat GOLGA5 Protein | +Inquiry |
TYW3-5014C | Recombinant Chicken TYW3 | +Inquiry |
RFL2798XF | Recombinant Full Length Xenopus Tropicalis Solute Carrier Family 25 Member 40(Slc25A40) Protein, His-Tagged | +Inquiry |
FGA-7799Z | Recombinant Zebrafish FGA | +Inquiry |
ST1916-P01-1492S | Recombinant Streptomyces lividans ST1916_P01 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1779G | Active Native Griffonia Simplicifolia Lectin I Protein, Biotinylated | +Inquiry |
ALB-7995H | Native Human Serum Albumin(Protease Free) | +Inquiry |
CA 19-9-378H | Active Native Human Cancer Antigen 19-9 | +Inquiry |
Factor Xia-65H | Native Human Factor Xia | +Inquiry |
Lectin-1780G | Active Native Griffonia Simplicifolia Lectin I Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABCF1-7HCL | Recombinant Human ABCF1 cell lysate | +Inquiry |
MAGEA8-4550HCL | Recombinant Human MAGEA8 293 Cell Lysate | +Inquiry |
DCX-7032HCL | Recombinant Human DCX 293 Cell Lysate | +Inquiry |
SEPT1-1967HCL | Recombinant Human SEPT1 293 Cell Lysate | +Inquiry |
NKX3-3811HCL | Recombinant Human NKX3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MPS2 Products
Required fields are marked with *
My Review for All MPS2 Products
Required fields are marked with *
0
Inquiry Basket