Recombinant Full Length Saccharomyces Cerevisiae Monopolar Spindle Protein 2(Mps2) Protein, His-Tagged
Cat.No. : | RFL35619SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Monopolar spindle protein 2(MPS2) Protein (C7GW39) (1-387aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-387) |
Form : | Lyophilized powder |
AA Sequence : | MSNGAFDAIFEYAWGQIDKPISGDFIYGKDLPKLIEIIENIFQKAQKSGSYELRLPLFSE INKDLFRTFSNTKTFFKIHKEEFDDIFFNLVNHPLREILENAFIGVDSIPSDFIVSMNLN SPSKFLVENKSKNTEGAGISTPRKKLTESPIKLLSRNNIGKALEVQVEELKRELTAKQSL LQENERQVSELKIRLETYQEKYASIQQRFSDLQKARQVEDNQNSSRTSDPGSPLVTGIDQ KAILEEFRRRLQRQTDTISFLKDQIRRERGLNCSNDKVSHSKRKHATTDGDGTFKNFISA VPSNIWVKATIRIIVCFALLAGVLPYIRKYVYAHDTPSQNSRLQLSWWENSGILSKIVWF FEDQTDLETEYRSNANVDDAYSRVFGI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MPS2 |
Synonyms | MPS2; MMC1; C1Q_04711; Monopolar spindle protein 2 |
UniProt ID | C7GW39 |
◆ Recombinant Proteins | ||
Plat-4907M | Recombinant Mouse Plat Protein, Myc/DDK-tagged | +Inquiry |
PROCR-3909H | Recombinant Human PROCR Protein (Met1-Thr209), C-His tagged | +Inquiry |
ROD1-1229H | Recombinant Human ROD1 protein, GST-tagged | +Inquiry |
RFL10019PF | Recombinant Full Length Pyrococcus Furiosus Upf0290 Protein Pf0398(Pf0398) Protein, His-Tagged | +Inquiry |
PKH12-P1-3504S | Recombinant Staphylococcus aureus (strain: JY43) PKH12_P1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CSK-27872TH | Native Human CSK | +Inquiry |
AHSG-111H | Native Human Alpha 2 HS Glycoprotein | +Inquiry |
Ngf-182M | Active Native Mouse Ngf Protein | +Inquiry |
Insulin-04B | Native Bovine Insulin Protein | +Inquiry |
KRT19-5H | Native Human CK19 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZFAND4-27HCL | Recombinant Human ZFAND4 lysate | +Inquiry |
RBCK1-2487HCL | Recombinant Human RBCK1 293 Cell Lysate | +Inquiry |
CCDC74A-7749HCL | Recombinant Human CCDC74A 293 Cell Lysate | +Inquiry |
HHIP-784HCL | Recombinant Human HHIP cell lysate | +Inquiry |
GSTM5-760HCL | Recombinant Human GSTM5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All MPS2 Products
Required fields are marked with *
My Review for All MPS2 Products
Required fields are marked with *
0
Inquiry Basket