Recombinant Full Length Saccharomyces Cerevisiae Monopolar Spindle Protein 2(Mps2) Protein, His-Tagged
Cat.No. : | RFL4468SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Monopolar spindle protein 2(MPS2) Protein (P53159) (1-387aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-387) |
Form : | Lyophilized powder |
AA Sequence : | MSNGAFDAIFEYAWGQIDKPISGDFIYGKDLPKLIEIIENIFQKAQKSGSYELRLPLFSE INKDLFRTFSNTKTFFKIHKEEFDDIFFNLVNHPLREILENAFIGVDSIPSDFIVSMNLN SPSKFLVENKNKNTEGAGISTPRKKLTESPIKLLSRNNIGKALEVQVEELKRELTAKQSL LQENERQVSELKIRLETYQEKYASIQQRFSDLQKARQVEDNQNSSRTSDPGSPLVTGIDQ KAILEEFRRRLQRQTDTISFLKDQIRRERGLNCSNDKVSHSKRKHATTDGDGTFKNFISA VPSNIWVKATIRIIVCFALLAGVLPYIRKYVYAHDTPSQNSRLQLSWWENSGILSKIVWF FEDQTDLETEYRSNANVDDAYSRVFGI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MPS2 |
Synonyms | MPS2; MMC1; YGL075C; Monopolar spindle protein 2 |
UniProt ID | P53159 |
◆ Recombinant Proteins | ||
PTPN22-7279M | Recombinant Mouse PTPN22 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL36795GF | Recombinant Full Length Chicken Growth Hormone Receptor(Ghr) Protein, His-Tagged | +Inquiry |
Fosl1-3069M | Recombinant Mouse Fosl1 Protein, Myc/DDK-tagged | +Inquiry |
S-5501S | Recombinant SARS-CoV-2 RBD Protein (Thr333-Pro527), C-His tagged | +Inquiry |
ERBB222298H | Recombinant Human HER2 (1-629) Protein | +Inquiry |
◆ Native Proteins | ||
FSHB-672H | Native Human Follicle Stimulating Hormone, Beta Polypeptide | +Inquiry |
CELA3B-25P | Native Porcine Elastase Protein | +Inquiry |
LDH-121B | Active Native Bovine Lactate Dehydrogenase | +Inquiry |
SUMO Protease-01 | Native purified SUMO Protease, N-His-tagged | +Inquiry |
ITGA2B-10H | Native Human GPIIbIIIa | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDE9A-609HCL | Recombinant Human PDE9A cell lysate | +Inquiry |
FKBP11-6212HCL | Recombinant Human FKBP11 293 Cell Lysate | +Inquiry |
KCNK10-646HCL | Recombinant Human KCNK10 Lysate | +Inquiry |
PDE6B-3346HCL | Recombinant Human PDE6B 293 Cell Lysate | +Inquiry |
SORBS2-1570HCL | Recombinant Human SORBS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MPS2 Products
Required fields are marked with *
My Review for All MPS2 Products
Required fields are marked with *
0
Inquiry Basket