Recombinant Full Length Saccharomyces Cerevisiae Mitochondrial Nicotinamide Adenine Dinucleotide Transporter 1(Yia6) Protein, His-Tagged
Cat.No. : | RFL13617SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Mitochondrial nicotinamide adenine dinucleotide transporter 1(YIA6) Protein (P40556) (1-373aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-373) |
Form : | Lyophilized powder |
AA Sequence : | MTQTDNPVPNCGLLPEQQYCSADHEEPLLLHEEQLIFPDHSSQLSSADIIEPIKMNSSTE SIIGTTLRKKWVPLSSTQITALSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYR GIMGTLSTIVRDEGPRGLYKGLVPIVLGYFPTWMIYFSVYEFSKKFFHGIFPQFDFVAQS CAAITAGAASTTLTNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGL VPSLLGLFHVAIHFPIYEDLKVRFHCYSRENNTNSINLQRLIMASSVSKMIASAVTYPHE ILRTRMQLKSDIPDSIQRRLFPLIKATYAQEGLKGFYSGFTTNLVRTIPASAITLVSFEY FRNRLENISTMVI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | YIA6 |
Synonyms | YIA6; NDT1; YIL006W; Mitochondrial nicotinamide adenine dinucleotide transporter 1; Mitochondrial NAD(+ transporter 1 |
UniProt ID | P40556 |
◆ Recombinant Proteins | ||
CLEC5A-2162HF | Recombinant Full Length Human CLEC5A Protein, GST-tagged | +Inquiry |
TP53I13-5889R | Recombinant Rat TP53I13 Protein, His (Fc)-Avi-tagged | +Inquiry |
LOXL1-3181H | Recombinant Human LOXL1 protein, His-tagged | +Inquiry |
TLR4-886H | Active Recombinant Human TLR4 Protein, Ser & His-tagged | +Inquiry |
CHRDL1-1267H | Recombinant Human CHRDL1 Protein, GST-Tagged | +Inquiry |
◆ Native Proteins | ||
KRT19-382H | Native Human KRT19 | +Inquiry |
Thrombin-61M | Active Native Mouse Thrombin | +Inquiry |
IgG-7438M | Native Mouse IgG Fc Protein, Biotin conjugated | +Inquiry |
PHAL-01P | Active Native Phaseolus vulgaris lectin L Protein | +Inquiry |
HP-127H | Native Human Hemoglobin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BNIPL-8421HCL | Recombinant Human BNIPL 293 Cell Lysate | +Inquiry |
PDLIM1-3327HCL | Recombinant Human PDLIM1 293 Cell Lysate | +Inquiry |
OTUD6B-3514HCL | Recombinant Human OTUD6B 293 Cell Lysate | +Inquiry |
PDK3-3328HCL | Recombinant Human PDK3 293 Cell Lysate | +Inquiry |
MAD2L1BP-4569HCL | Recombinant Human MAD2L1BP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All YIA6 Products
Required fields are marked with *
My Review for All YIA6 Products
Required fields are marked with *
0
Inquiry Basket