Recombinant Full Length Saccharomyces Cerevisiae Cytochrome B Mrna Maturase Bi2(Bi2) Protein, His-Tagged
Cat.No. : | RFL12633SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Cytochrome b mRNA maturase bI2(bI2) Protein (P03873) (1-423aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-423) |
Form : | Lyophilized powder |
AA Sequence : | MAFRKSNVYLSLVNSYIIDSPQPSSINYWWNMGSLLGLCLVIQIVTGIFMAMHYSSNIEL AFSSVEHIMRDVHNGYILRYLHANGASFFFMVMFMHMAKGLYYGSYRSPRVTLWNVGVII FILTIATAFLGYCCVYGQMSHWGNMNIASNMFNMMKTIYMMMLMLLIYIFYTIMMRQMMK TKEYTMLIKSMDYINKNKYMINLNMTNKKDMNNNIGPLNMNILSIIYGSMLGDGHAEKRK GGKGTRIVFQQEYCNINYLYYLHSLLANLGYCNTNLPLIKTRLGKKGKIRQYLKFNTWTY DSFNMIYSEWYIKNMSGKGNIKVIPKSLDNYLTPLALAIWIMDDGCKLGKGLKFTTNCFS YKDVQYLTYLLHNKYNIKSTITKGNKENTQFVIYVWKESMPILTKIVSPYIIPSMKYKLG NYL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BI2 |
Synonyms | BI2; Q0110; Cytochrome b mRNA maturase bI2 |
UniProt ID | P03873 |
◆ Recombinant Proteins | ||
CLDN6-795H | Active Recombinant Fluorescent Human CLDN6 protein, Flag-His&GFP-tagged(Nanodisc) | +Inquiry |
SV2C-6852Z | Recombinant Zebrafish SV2C | +Inquiry |
SOST-5332R | Recombinant Rat SOST Protein, His (Fc)-Avi-tagged | +Inquiry |
MPV17-5522H | Recombinant Human MPV17 Protein, GST-tagged | +Inquiry |
PDGFRA-1498HFL | Recombinant Full Length Human PDGFRA Protein, C-Flag-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1781G | Active Native Griffonia Simplicifolia Lectin I Protein | +Inquiry |
AMY2A-8353H | Native Human AMY2A | +Inquiry |
Collagen-322H | Native Human Collagen IV | +Inquiry |
ALB-21H | Native Human ALB protein | +Inquiry |
TF-8273H | Native Human Serum Transferrin HOLO(iron-saturated) | +Inquiry |
◆ Cell & Tissue Lysates | ||
Duodenum-110H | Human Duodenum Liver Cirrhosis Lysate | +Inquiry |
C19orf6-8198HCL | Recombinant Human C19orf6 293 Cell Lysate | +Inquiry |
Testis-792D | Dog Testis Membrane Lysate, Total Protein | +Inquiry |
Uterus-665G | Guinea Pig Uterus Lysate, Total Protein | +Inquiry |
CHAF1A-7548HCL | Recombinant Human CHAF1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All BI2 Products
Required fields are marked with *
My Review for All BI2 Products
Required fields are marked with *
0
Inquiry Basket