Recombinant Full Length Saccharomyces Cerevisiae Autophagy-Related Protein 32(Atg32) Protein, His-Tagged
Cat.No. : | RFL563SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Autophagy-related protein 32(ATG32) Protein (B3LTZ3) (1-529aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-529) |
Form : | Lyophilized powder |
AA Sequence : | MVLEYQQREGKGSSSKSMPPDSSSTTIHTCSEAQTGEDKGLLDPHLSVLELLSKTGHSPS PMGQNLVTSIDISGNHNVNDSISGSWQAIQPLDLGASFIPERCSSQTTNGSILSSSDTSE EEQELLQAPAADIINIIKQGQEGANVVSPSHPFKQLQKIISLPLPGKEKTPFNEQDDDGD EDEAFEEDSVTITKSLTSSTNSFVMPKLSLTQKNPVFRLLILGRTGSSFYQSIPKEYQSL FELPKYHDSATFPQYTGIVIIFQELREMVSLLNRIVQYSPGKPVIPICQPGQVIQVKNVL KSFLRNKLVKLLFPPVVVTNKRDLKKMFQRLQDLSLEYGEDVNEEDNDDEAIHTKSRSYC RNKKAENSKKKSPKSNKKPKRKKQKFFTSWFTWGISITIGISFGCCVTYFVTAAYEHQTV KSLSLRPSILASLLSLDSSSDTINTPATASPSSTEQFLWFDKGTLQINFHSDGFIMKSLT IIKETWGKMNTFVLHALSKPLKFLENLNKSSEFSIDESNRILALGYILL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ATG32 |
Synonyms | ATG32; ECM17; SCRG_05318; Autophagy-related protein 32; Extracellular mutant protein 37 |
UniProt ID | B3LTZ3 |
◆ Recombinant Proteins | ||
HSPB3-3625H | Recombinant Human HSPB3, His-tagged | +Inquiry |
ITGB1BP1-4985H | Recombinant Human ITGB1BP1 Protein, GST-tagged | +Inquiry |
COTI-1377B | Recombinant Bacillus subtilis COTI protein, His-tagged | +Inquiry |
TNFSF4-886M | Recombinant Mouse TNFSF4 Protein (Gln49-Leu198), MIgG1 Fc-tagged | +Inquiry |
DDX6-28328TH | Recombinant Human DDX6 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Apotransferrin-37D | Native dog Apotransferrin | +Inquiry |
COP34 | Native Ginkgo Biloba L. EP7 | +Inquiry |
TPO-8266H | Native Human Thyroid Peroxidase | +Inquiry |
IgG2-230H | Native Human Immunoglobulin G2 (IgG2) | +Inquiry |
LDL-243H | Native Human Lipoproteins, Intermediate Density | +Inquiry |
◆ Cell & Tissue Lysates | ||
NT5C3-3675HCL | Recombinant Human NT5C3 293 Cell Lysate | +Inquiry |
CSF2-740RCL | Recombinant Rat CSF2 cell lysate | +Inquiry |
NKIRAS2-3817HCL | Recombinant Human NKIRAS2 293 Cell Lysate | +Inquiry |
FOXO4-6147HCL | Recombinant Human FOXO4 293 Cell Lysate | +Inquiry |
TAL1-1259HCL | Recombinant Human TAL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATG32 Products
Required fields are marked with *
My Review for All ATG32 Products
Required fields are marked with *
0
Inquiry Basket