Recombinant Full Length Rickettsia Conorii Protein Translocase Subunit Secd(Secd) Protein, His-Tagged
Cat.No. : | RFL20653RF |
Product Overview : | Recombinant Full Length Rickettsia conorii Protein translocase subunit SecD(secD) Protein (Q92H77) (1-518aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rickettsia conorii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-518) |
Form : | Lyophilized powder |
AA Sequence : | MQKLPKWKIFLSIICTVFAVICALPNFMQVNSKFLPHDSVNLGLDLRGGAHLLLDVDFDT YLNDSMENLADTLRKNFREDKIGYKNLLVRQNSIQLEVRSPEKLKPLKKIINKIDPEIIA EVNENKIKLSYSESRLNDLLNKVVDQSIEIVRMRVDSTGTKEPTLQKQGDKHILLQVPGE ENPSYLKNILGKTAKLTFHLVDENANIEEAVKGHVPVGSMLVKGDNASHGEYYVVIKKKV VLGGDQLTTASASFDQNSQAVVAFSFNNLGSKIFGEITKNNIGKRLAIVLDNKLLSAPTI NGAIMGGSGIITGNFTVESANELALLLRAGSLPAPLKIIEERSIGPNLGADSIESGKKAG LIGFIAVCIFMVWSYGVLGLFANIALSLALLYILALLSLFQATLTLPGIAGIILTMGMAV DANVLIYERIKEELHKGVSTLYAIRTGFESAFATILDANLTTLIVAFLLYIFGVGAIKGF AVALTIGIISSMFSAIIITKLLIDIWVQYFKPKKLGLV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | secD |
Synonyms | secD; RC0894; Protein translocase subunit SecD |
UniProt ID | Q92H77 |
◆ Recombinant Proteins | ||
MRGPRB5-3752R | Recombinant Rat MRGPRB5 Protein | +Inquiry |
EGR3-398H | Recombinant Human EGR3 Protein, MYC/DDK-tagged | +Inquiry |
CXCL1-001H | Recombinant Human CXCL1 Protein, MBP-tagged | +Inquiry |
IL33-121H | Active Recombinant Human Interleukin 33, MIgG2a Fc-tagged | +Inquiry |
CD1A-25H | Recombinant Human CD1A protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
CGB-1856H | Native Human Chorionic Gonadotropin, Beta Polypeptide | +Inquiry |
EPX-8107H | Native Human Eosinophil Peroxidase | +Inquiry |
FSH-1565S | Active Native Sheep Stimulating Hormone | +Inquiry |
Elastase-01H | Active Native Human Sputum Leucocyte Elastase | +Inquiry |
BCHE-5291H | Native Human Butyrylcholinesterase | +Inquiry |
◆ Cell & Tissue Lysates | ||
USP47-728HCL | Recombinant Human USP47 lysate | +Inquiry |
GIMAP4-5938HCL | Recombinant Human GIMAP4 293 Cell Lysate | +Inquiry |
HIP1R-789HCL | Recombinant Human HIP1R cell lysate | +Inquiry |
FCGR2B-1988HCL | Recombinant Human FCGR2B cell lysate | +Inquiry |
GNAI2-5870HCL | Recombinant Human GNAI2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All secD Products
Required fields are marked with *
My Review for All secD Products
Required fields are marked with *
0
Inquiry Basket