Recombinant Full Length Borrelia Burgdorferi Protein Translocase Subunit Secd(Secd) Protein, His-Tagged
Cat.No. : | RFL35340BF |
Product Overview : | Recombinant Full Length Borrelia burgdorferi Protein translocase subunit SecD(secD) Protein (O51596) (1-586aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Borrelia Burgdorferi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-586) |
Form : | Lyophilized powder |
AA Sequence : | MKKGSKLILILLVTFFACLLIFPTLKWYFLMSVEDKKISSYSQEALRDYSKKKALNDLVK LKELYNKDPNSSIPASLSYLIPIAKNNYRSSMKIPPNIFTAKTLREGFLTDSDMGEVSLE IYRYYENIKKGKSRIIHLGLDLSGGMSVTISLDYSSVEKKLGRSLTFAEREDAIYRIMQI LKDRVBRFGLTEPKIVREAGGNKIFLDIPGEKDESRVSTLLSGKGNLTFYVVDDESTSLL HRKILEAGSLFSIPEIQASMNLPDSKQIFPWYVKDSYGVDDESSVRYYVVDASPENSFDG AHIKDAGVSNDPRTGRDTVAFSLDVDGSEKFFKFTQKNVGKSLAVVMEGKIKSVAGIGYA ITGGNVSIQGDSFDKKEAQDLALVFKTAAFPVDIKIDDLRIIGPTLGARTIDLGIKASAL ALCLVFLFICVYYGLSGVVAGFSLVIYNVFLILAILSAFNFTLTLTSIAGLILTMGMAVD INIVIYERIKEEIREGRRFENAFEAGFKKAFLSIMDANITTFIAVLFLTLLGTGVIQGFA WSLSVGIVASLFSSLIFSRFILEFIISVRKSKFISISWSSKYAKSN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | secD |
Synonyms | secD; BB_0652; Protein translocase subunit SecD |
UniProt ID | O51596 |
◆ Native Proteins | ||
SERPINA7-30623TH | Native Human SERPINA7 | +Inquiry |
CNAN-133A | Native Arachis hypogaea seed Conarachin | +Inquiry |
APOC2-4904H | Native Human Apolipoprotein CII | +Inquiry |
CTSH-360H | Native Human Eosinophil Peroxidase | +Inquiry |
Cela1 -71R | Active Native Rat pancreatic elastase | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAPK7-4490HCL | Recombinant Human MAPK7 293 Cell Lysate | +Inquiry |
INTS12-5188HCL | Recombinant Human INTS12 293 Cell Lysate | +Inquiry |
GUSBP5-4683HCL | Recombinant Human LOC441046 293 Cell Lysate | +Inquiry |
ARL13B-8720HCL | Recombinant Human ARL13B 293 Cell Lysate | +Inquiry |
EIF2AK1-538HCL | Recombinant Human EIF2AK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All secD Products
Required fields are marked with *
My Review for All secD Products
Required fields are marked with *
0
Inquiry Basket