Recombinant Full Length Methanopyrus Kandleri Protein Translocase Subunit Secd(Secd) Protein, His-Tagged
Cat.No. : | RFL29047MF |
Product Overview : | Recombinant Full Length Methanopyrus kandleri Protein translocase subunit SecD(secD) Protein (Q8TWM4) (1-403aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Methanopyrus kandleri |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-403) |
Form : | Lyophilized powder |
AA Sequence : | MSGLGWMKENWRLLVITAVWIVAATSLAVKGVNLGLELKGGTMVIAKTDHPVSKKEMDQT VTVLESRLSTFGFKGIKIQPVGRDHIIVMLPGTPPKEAVELITKPGRFEAKYKGKTVITG QDIESVESPRIERVEGGYQWSVPFRLTAEGARKFAEVAKNAPGQPIDMYLDNKKVSSPRI SEDLAMAAASGHMEREIEIVGGAKTKEQAEREAKEIMAVLRSGQLPAKLVPEGVYSVSAT LGQNFLKMAMIAGAIAFAAVSVIIALRYRDIRISGPILFTGSSEVVFLIGLASLTGFTID LPALAGIILSIGSGVDDLIVITDEIVRGERRKEEVTLRQRIKRAFSVVLASFATLAAAMA VLFVAGMGLLKGFAIMTIAGAFYGVVITRPVYADLLKKILGTE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | secD |
Synonyms | secD; MK1009; Protein-export membrane protein SecD |
UniProt ID | Q8TWM4 |
◆ Recombinant Proteins | ||
SAOUHSC-01371-3637S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 SAOUHSC_01371 protein, His-tagged | +Inquiry |
CEACAM7-63H | Recombinant Human CEACAM7, His-tagged | +Inquiry |
RAB23-303H | Recombinant Human RAB23 protein, GST-tagged | +Inquiry |
SHARPIN-15087M | Recombinant Mouse SHARPIN Protein | +Inquiry |
TMEM18-1991C | Recombinant Chicken TMEM18 | +Inquiry |
◆ Native Proteins | ||
Prothrombin-4S | Native Snake E. Carinatus Viper Venom Prothrombin Activator | +Inquiry |
Lectin-1769D | Active Native Dolichos Biflorus Agglutinin Protein, Biotinylated | +Inquiry |
G6PD-26 | Active Native Glucose-6-phosphate dehydrogenase | +Inquiry |
BL-001C | Native Cynomolgus Brain Total Protein Lysates | +Inquiry |
NEFH-181B | Native Bovine NEFH Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLF6-4926HCL | Recombinant Human KLF6 293 Cell Lysate | +Inquiry |
OR2C1-1252HCL | Recombinant Human OR2C1 cell lysate | +Inquiry |
TCTN3-1158HCL | Recombinant Human TCTN3 293 Cell Lysate | +Inquiry |
HYKK-387HCL | Recombinant Human HYKK lysate | +Inquiry |
FSD2-286HCL | Recombinant Human FSD2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All secD Products
Required fields are marked with *
My Review for All secD Products
Required fields are marked with *
0
Inquiry Basket