Recombinant Full Length Elusimicrobium Minutum Protein Translocase Subunit Secd(Secd) Protein, His-Tagged
Cat.No. : | RFL27430EF |
Product Overview : | Recombinant Full Length Elusimicrobium minutum Protein translocase subunit SecD(secD) Protein (B2KBZ1) (1-473aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Elusimicrobium minutum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-473) |
Form : | Lyophilized powder |
AA Sequence : | MSNKVLVKWAVILVALFASVYLLYPVYKWYSLSNEDRAKLEASGDRPKNILNLGLDLRGG SSLLLELDVTKLPDNTPAARNDAVSRAIEIIRNRIDQYGVAETPITRQGEKWISVQLPGI ANPAQAEALIGKTAMLEFRIVKPQTSALDKAAAKIEDTEEPWDEDGNLIPSLAKLLPADT IVLKNKEGGFSFLEKEVKVTGADLENAQVNVGGDYGYPEVSFTFSAEGAKKFGSLTGSNI GKQLAIVLDNTVQSAPSIQSRITRDGRISGRFTMDEARRLAITLRAGALPAPVKIIEKRT IGPSLGEDSIKSGVRASLYGIVIILILMAIYYKSGGIISNIALILNLVFLLAAMAAFNAT LTMPGIAGIILSLAMAIDANVLILERMREEKLRGRSLYEMIDLGYTKAWSAIFDSNFTSW IVALFLFQFGSGPVKGFAVTLTLGLLIGVFTSVFVTRAIYDLLLTANPKDISL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | secD |
Synonyms | secD; Emin_0563; Protein translocase subunit SecD |
UniProt ID | B2KBZ1 |
◆ Native Proteins | ||
ALB-21H | Native Human ALB protein | +Inquiry |
IBV-06I | Native Influenza B Antigen | +Inquiry |
IgA-252H | Native Human Immunoglobulin A | +Inquiry |
Proteoglycans-54B | Native Bovine Proteoglycans | +Inquiry |
F9-671H | Native Human Coagulation Factor IX | +Inquiry |
◆ Cell & Tissue Lysates | ||
CC2D1B-7798HCL | Recombinant Human CC2D1B 293 Cell Lysate | +Inquiry |
ERG-6560HCL | Recombinant Human ERG 293 Cell Lysate | +Inquiry |
MAGEB2-4545HCL | Recombinant Human MAGEB2 293 Cell Lysate | +Inquiry |
C22orf31-8092HCL | Recombinant Human C22orf31 293 Cell Lysate | +Inquiry |
GGT1-1344RCL | Recombinant Rat GGT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All secD Products
Required fields are marked with *
My Review for All secD Products
Required fields are marked with *
0
Inquiry Basket