Recombinant Full Length Rhodothermus Marinus Protein Translocase Subunit Secd(Secd) Protein, His-Tagged
Cat.No. : | RFL25276RF |
Product Overview : | Recombinant Full Length Rhodothermus marinus Protein translocase subunit SecD(secD) Protein (D0MIN4) (1-622aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhodothermus marinus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-622) |
Form : | Lyophilized powder |
AA Sequence : | MKRNGFKIGVTLALLLLCGYYLYPTVRYALLQRKLNRMSEEERAAFIEANYGTIQSLRER ALKLGLDLQGGMHVTLEVRVDALIRELATDVDETFEEVLAAARERARSGDVSLIDAFVEE FERRDPNARLSRYFRNPDAGITRRSSNEEVAAYLRQQAEEAVNRAIEIIRDRVDRYGVTE PVIQKQGTRRIVVELPGVDDPERVRRLLRGTARLEFRLMADPQLLQAALQDIIAYYEPDT TAASETSAVTDTATADTSLAALLGEQPSPERPRNPLLAVMQPVGQGVVFGIVAGPDTAQV NRLLRNPEVQALLPSGIELLYTANPVGTDEQGRPLYYLLGVRKEVELTGEVITDARVEFD ELNRPQVSMTMNSEGARIWARLTGANVGKHIAIVLDNVVYSYPVVNERIPSGRSSITGLD SREEAQDIVTVLKSGALPAPVDIIEERTVGPSLGEASIRAGLRSVLTGLLLVALFMIFYY RTGGMIADLALVLNIIFILGILAAFNATLTLPGIAGIVLTIGMAVDANVLIFERIREEQA TGKTLRAAIDLGYSKAFSAIFDANITTFFTAAILYSFGVGPIQGFAVTLMAGIAASLFSA IVITRIIFDYLVLERKLMVSVG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | secD |
Synonyms | secD; Rmar_1455; Protein translocase subunit SecD |
UniProt ID | D0MIN4 |
◆ Recombinant Proteins | ||
FABP2-4421HF | Recombinant Full Length Human FABP2 Protein, GST-tagged | +Inquiry |
TNK2-5862R | Recombinant Rat TNK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SAP064A-017-2603S | Recombinant Staphylococcus aureus (strain: EMRSA-3, other: HA-MRSA) SAP064A_017 protein, His-tagged | +Inquiry |
Adad1-1527M | Recombinant Mouse Adad1 Protein, Myc/DDK-tagged | +Inquiry |
SPARC-6051H | Recombinant Human SPARC Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
Luciferase-10V | Native Vibrio fischeri Luciferase | +Inquiry |
COD-39 | Active Native Choline oxidase | +Inquiry |
NEFM-179B | Native bovine NEFM | +Inquiry |
MPOA-233H | Native Human Myeloperoxidase Isoform A | +Inquiry |
CAT-101B | Active Native Bovine CAT | +Inquiry |
◆ Cell & Tissue Lysates | ||
Pancreas-369H | Human Pancreas Membrane Tumor Lysate | +Inquiry |
PDPN-2687MCL | Recombinant Mouse PDPN cell lysate | +Inquiry |
DHRS11-6940HCL | Recombinant Human DHRS11 293 Cell Lysate | +Inquiry |
AOAH-8824HCL | Recombinant Human AOAH 293 Cell Lysate | +Inquiry |
CD9-2110HCL | Recombinant Human CD9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All secD Products
Required fields are marked with *
My Review for All secD Products
Required fields are marked with *
0
Inquiry Basket