Recombinant Full Length Treponema Pallidum Protein Translocase Subunit Secd(Secd) Protein, His-Tagged
Cat.No. : | RFL24252TF |
Product Overview : | Recombinant Full Length Treponema pallidum Protein translocase subunit SecD(secD) Protein (O83425) (1-583aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Treponema Pallidum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-583) |
Form : | Lyophilized powder |
AA Sequence : | MSKKARFGVVLVVLAACSGFLFPTLQWYFLTDAQTRQRALSSREQIKEYAVQSAERDLAD LTRLARAGSDEDISARYAPLVAAARQNLSYSGRPAPSRWTAAALVSAFPVKSEQGFVLYA RPLMEQTYREAVLKMKRRQAQAVKLGLDLSGGTSVVIKADLSEVTKGVPDAERAAIRSEA MALVLSTLENRINRFGLSEPVIRRQGEDRVYVEIPGLTDRDRVHSIVMGRGVLAFHLVDD DATQKLLDHYRNNPQGTFDAAHQLHDLSLVPEHTSVLGVYRKDSYGLDVRDGFLVVKKEP ALEGRHIRDATVSSGRANEPLVLFDLDHEGARIFSELTTKEIGRRLAIVSDGKIRSAPAI REPITAGSGSISGFSAEEAQNLKTALRSAWLNVALEIENQQVVGASMGEESIRQGTRALV WGLCAVLLFMLVWYQEAGVNACVAQLLNLYIMFGVLSAFNLTLTLSSIAGMILTIGMAVD ANVVVFERIREELALGKSRGAAVCSGFERAFWAIMDSNVTTFIAALFLSVLGTGPIKGFA YSLAIGVVSSVFTALFVSRLMFDYGTEVLHKKTVRIGWRIARV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | secD |
Synonyms | secD; TP_0410; Protein translocase subunit SecD |
UniProt ID | O83425 |
◆ Recombinant Proteins | ||
ATP5J-10025H | Recombinant Human ATP5J, GST-tagged | +Inquiry |
METTL22-2567R | Recombinant Rhesus Macaque METTL22 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL6410EF | Recombinant Full Length Monofunctional Biosynthetic Peptidoglycan Transglycosylase(Mtga) Protein, His-Tagged | +Inquiry |
YRVD-3956B | Recombinant Bacillus subtilis YRVD protein, His-tagged | +Inquiry |
HEATR7B2-4109M | Recombinant Mouse HEATR7B2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
ALB-293B | Native Bovine ALB Protein, TRITC-labeled | +Inquiry |
Lectin-1719P | Native Peanut Lectin, FITC conjugated | +Inquiry |
CVB6-14 | Native Coxsackievirus B6 Antigen | +Inquiry |
FN1-2708H | Native Human FN1 protein | +Inquiry |
OX-LDL-985H | Native Human Lipoproteins, Oxidized LDL protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SFXN5-1891HCL | Recombinant Human SFXN5 293 Cell Lysate | +Inquiry |
TBX5-1198HCL | Recombinant Human TBX5 293 Cell Lysate | +Inquiry |
MAGEB1-4548HCL | Recombinant Human MAGEB1 293 Cell Lysate | +Inquiry |
TYMS-1868HCL | Recombinant Human TYMS cell lysate | +Inquiry |
SOCS5-1579HCL | Recombinant Human SOCS5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All secD Products
Required fields are marked with *
My Review for All secD Products
Required fields are marked with *
0
Inquiry Basket