Recombinant Full Length Protein Translocase Subunit Secd(Secd) Protein, His-Tagged
Cat.No. : | RFL10114EF |
Product Overview : | Recombinant Full Length Protein translocase subunit SecD(secD) Protein (P0AG91) (1-615aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-615) |
Form : | Lyophilized powder |
AA Sequence : | MLNRYPLWKYVMLIVVIVIGLLYALPNLFGEDPAVQITGARGVAASEQTLIQVQKTLQEE KITAKSVALEEGAILARFDSTDTQLRAREALMGVMGDKYVVALNLAPATPRWLAAIHAEP MKLGLDLRGGVHFLMEVDMDTALGKLQEQNIDSLRSDLREKGIPYTTVRKENNYGLSITF RDAKARDEAIAYLSKRHPDLVISSQGSNQLRAVMSDARLSEAREYAVQQNINILRNRVNQ LGVAEPVVQRQGADRIVVELPGIQDTARAKEILGATATLEFRLVNTNVDQAAAASGRVPG DSEVKQTREGQPVVLYKRVILTGDHITDSTSSQDEYNQPQVNISLDSAGGNIMSNFTKDN IGKPMATLFVEYKDSGKKDANGRAVLVKQEEVINIANIQSRLGNSFRITGINNPNEARQL SLLLRAGALIAPIQIVEERTIGPTLGMQNIEQGLEACLAGLLVSILFMIIFYKKFGLIAT SALIANLILIVGIMSLLPGATLSMPGIAGIVLTLAVAVDANVLINERIKEELSNGRTVQQ AIDEGYRGAFSSIFDANITTLIKVIILYAVGTGAIKGFAITTGIGVATSMFTAIVGTRAI VNLLYGGKRVKKLSI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | secD |
Synonyms | secD; Z0507; ECs0459; Protein translocase subunit SecD |
UniProt ID | P0AG91 |
◆ Recombinant Proteins | ||
RFL10412PF | Recombinant Full Length Pongo Abelii Protein Cnppd1(Cnppd1) Protein, His-Tagged | +Inquiry |
CD3E & CD3D-2972C | Active Recombinant Cynomolgus CD3E & CD3D protein | +Inquiry |
Spa17-1383M | Recombinant Mouse Spa17 protein, His-tagged | +Inquiry |
RFL33884XF | Recombinant Full Length Xenopus Tropicalis Phosphatidylserine Synthase 2(Ptdss2) Protein, His-Tagged | +Inquiry |
SPATS2L-15849M | Recombinant Mouse SPATS2L Protein | +Inquiry |
◆ Native Proteins | ||
Cry2Ab-37B | Native Bacillus thuringiensis Cry2Ab Protein | +Inquiry |
Lectin-1785G | Active Native Griffonia Simplicifolia Lectin I isolectin B4 Protein, Fluorescein labeled | +Inquiry |
URG-94H | Active Native Human Urokinase | +Inquiry |
IGHG1-617H | Native Human Immunoglobulin Heavy Constant Gamma 1 (G1m marker) | +Inquiry |
Lectin-1797L | Active Native Lotus Tetragonolobus Lectin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPINK4-2395HCL | Recombinant Human SPINK4 cell lysate | +Inquiry |
EIF2S2-6665HCL | Recombinant Human EIF2S2 293 Cell Lysate | +Inquiry |
ZNF580-44HCL | Recombinant Human ZNF580 293 Cell Lysate | +Inquiry |
VDAC2-418HCL | Recombinant Human VDAC2 293 Cell Lysate | +Inquiry |
PHLDA1-3221HCL | Recombinant Human PHLDA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All secD Products
Required fields are marked with *
My Review for All secD Products
Required fields are marked with *
0
Inquiry Basket