Recombinant Full Length Rhodospirillum Rubrum Macrolide Export Atp-Binding/Permease Protein Macb(Macb) Protein, His-Tagged
Cat.No. : | RFL15614RF |
Product Overview : | Recombinant Full Length Rhodospirillum rubrum Macrolide export ATP-binding/permease protein MacB(macB) Protein (Q2RPB4) (1-650aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhodospirillum rubrum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-650) |
Form : | Lyophilized powder |
AA Sequence : | MADTPPPLIELIDLERVFDSSEVPVRALDRVSLTIHEGEFVAIIGQSGSGKSTLMSILGC LDRPTGGLYRLGGIDVASLDPVALAGLRRDTFGFVFQRYNLLAGASAAENVEMPAVYAGQ PRHQRLERAHALLDRLGMGARSGHFPNQLSGGQQQRVSIARALMNDPRVILADEPTGALD SASGRDVLALLEALHTEGRTVILITHDRDVAARAERVIALQDGRVVEDSGRPAPVGSDRP LGRPPGGAAYLGMAASFGEALKMAGRSLRANIFRTALTLLGVVIGVAAVVTMMAIGEGSK QDVLTRIQSMGTNLLLVRPGAPGIRPSGTDVSLTPTDAEAVAQLAGMAAVAPERMASGIT VRREGIDYRTTINGTWPAYAAAKDWPMAWGSFFDATDLQASAPVAVLGQTVAKNLFPGEE DPVGSYFLVRNVPFLVIGVLEAKGATPFGQDQDDIVLIPLTTAFARVSGGRYLSSLTARV EDATTIDESQAAIESLLQARHGKVDFQVRNTQSLLEMVEKTQNSLTLLLGAVALISLLVG GIGVMNIMLVSVTERTREIGIRLATGARASDILLQFNTEAVAVCGVGGLAGVGLGLGAAL AVAEFGLPVRFTPGPPIVAFCCAFLTGLLFGYLPARKAARLDPVVALSAE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB |
Synonyms | macB; Rru_A3236; Macrolide export ATP-binding/permease protein MacB |
UniProt ID | Q2RPB4 |
◆ Recombinant Proteins | ||
VTN-675H | Active Recombinant Human VTN Protein, His-tagged | +Inquiry |
ARGLU1A-12422Z | Recombinant Zebrafish ARGLU1A | +Inquiry |
GSTA3-13571H | Recombinant Human GSTA3, His-tagged | +Inquiry |
RFL26319TF | Recombinant Full Length Tolumonas Auensis Lipoprotein Signal Peptidase(Lspa) Protein, His-Tagged | +Inquiry |
SAP033A-015-3995S | Recombinant Staphylococcus aureus (strain: WBG8404, other: ST45-MRSA-V (5C2)) SAP033A_015 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
MMP2-47H | Native Human MMP-2/TIMP-2 Complex | +Inquiry |
HPX-207H | Native Human Hemopexin | +Inquiry |
Arg1-8044R | Native Rat Liver Arginase | +Inquiry |
Lung-017H | Human Lung Lysate, Total Protein | +Inquiry |
CA6-804H | Native Human CA6 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MS4A6A-4121HCL | Recombinant Human MS4A6A 293 Cell Lysate | +Inquiry |
SLC38A10-1725HCL | Recombinant Human SLC38A10 293 Cell Lysate | +Inquiry |
CLEC4F-1114RCL | Recombinant Rat CLEC4F cell lysate | +Inquiry |
HSDL2-820HCL | Recombinant Human HSDL2 cell lysate | +Inquiry |
DNAJC16-6877HCL | Recombinant Human DNAJC16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All macB Products
Required fields are marked with *
My Review for All macB Products
Required fields are marked with *
0
Inquiry Basket