Recombinant Full Length Salmonella Choleraesuis Macrolide Export Atp-Binding/Permease Protein Macb(Macb) Protein, His-Tagged
Cat.No. : | RFL29408SF |
Product Overview : | Recombinant Full Length Salmonella choleraesuis Macrolide export ATP-binding/permease protein MacB(macB) Protein (Q57R58) (1-648aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella choleraesuis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-648) |
Form : | Lyophilized powder |
AA Sequence : | MTALLELCNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKP TSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIERKK RQTRARELLLRLGLSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSG EEVMAILRQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAQEKKREQGVDAAV VNTAPGWRQFASSFREALSMAWLAMAANKMRTLLTMLGIIIGIASVVSIVVVGDAAKQMV LADIRAMGTNTIDIHPGKDFGDDNPQYRQALKYDDLVAIQKQPWVNSATPSVSKSLRLRY GNIDIAVNANGVSGDYFNVYGMSFREGNTFNAVQQQDRAQVVVLDANTRRQLFPNKANVV GEVVLAGNMPVIVIGVAEEKPSMYGNSNLLQVWLPYSTMSDRIMGQSWLNSITVRVKDGV DSDQAEQQLTRLLTLRHGKKDFFTWNMDSVLKTAEKTTYTLQLFLTLVAVISLVVGGIGV MNIMLVSVTERTREIGIRMAVGARASDVLQQFLIEAVLVCLVGGALGISLSMFIAFMLQL FLPGWEIGFSLTALASAFLCSTFTGILFGWLPARNAARLDPVDALARE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB |
Synonyms | macB; SCH_0897; Macrolide export ATP-binding/permease protein MacB |
UniProt ID | Q57R58 |
◆ Recombinant Proteins | ||
CD226-1607R | Recombinant Rhesus Monkey CD226 Protein | +Inquiry |
XKR8-5963H | Recombinant Human XKR8 Protein (Arg69-Arg158), N-His and N-SUMO tagged | +Inquiry |
HA-17-5632C | Recombinant Clostridium botulinum HA-17 protein, His-tagged | +Inquiry |
ATAD3B-931H | Recombinant Human ATAD3B protein, GST-tagged | +Inquiry |
Wipf3-7003M | Recombinant Mouse Wipf3 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
SERPINA1-P035H | Native Human alpha-1 proteinase inhibitor therapeutic protein (Aralast, Aralast NP, Glassia, Prolastin, Prolastin-C, Zemaira) | +Inquiry |
FGG -32B | Native Bovine Fibrinogen | +Inquiry |
VTN-31737TH | Native Human VTN | +Inquiry |
HBsAg-ad-21H | Native Human HBsAg protein (Subtype ad) | +Inquiry |
Lectin-1806L | Active Native Lycopersicon Esculentum Lectin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
AAGAB-631HCL | Recombinant Human AAGAB cell lysate | +Inquiry |
TMPO-913HCL | Recombinant Human TMPO 293 Cell Lysate | +Inquiry |
HES2-320HCL | Recombinant Human HES2 lysate | +Inquiry |
IDH3G-5303HCL | Recombinant Human IDH3G 293 Cell Lysate | +Inquiry |
HYAL1-5324HCL | Recombinant Human HYAL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All macB Products
Required fields are marked with *
My Review for All macB Products
Required fields are marked with *
0
Inquiry Basket