Recombinant Full Length Campylobacter Jejuni Macrolide Export Atp-Binding/Permease Protein Macb(Macb) Protein, His-Tagged
Cat.No. : | RFL21828CF |
Product Overview : | Recombinant Full Length Campylobacter jejuni Macrolide export ATP-binding/permease protein MacB(macB) Protein (Q5HVG3) (1-641aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Campylobacter jejuni |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-641) |
Form : | Lyophilized powder |
AA Sequence : | MIFLKNICKNIGENAILKNVSLSIEKGEFVAIIGQSGSGKTSLLNIIGTLDTPSSGTYVF DEYEVTKLNNDEKARLRREKIGFIFQRYNLLSLLSAKENVSLPAVYAGKNLQERSQNAKK LLNDLELAHKLDSKPNELSGGQQQRVSIARALINGGELILADEPTGALDSKSGIMVLEIL QKLNEQGHTIVLVTHDPKIAAQAKRVIEIKDGEILSDTKKEKAQEKLILKTMPKEKKTLT LLKNQAFECFKIAYSSILAHKLRSILTMLGIIIGIASVVCVVALGLGSQAKVLESIARLG TNTIEIRPGKGFGDLRSGKTRLNFSDLETLRSLEYLEAVDAHSNTSGVATYTNISLSARA EGVGVNNFAIEGLRIDAGRILNNDDVKNSTNVAVLDFNAKKNLFPDEKSENILGRVVLFN SQSFKIIGVLQKDTDKPIEDNVVRLYIPYTTLMNKLTGDRNLREIIVKVKDDVSSTLAEN AIIRILEIKRGQKDFFTFNSDTFKQAITANKRTTTILTACVAVIALIVGGIGVMNIMLVS VSERTREIGIRMAIGARREDIMMQFLIEAVMICTIGAILGVILSIFVIFAFNTLSTDFPM ILNAYSVLLGLLSSMFIGVVFGFFPARNAANLNPISALSKE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB |
Synonyms | macB; CJE0710; Macrolide export ATP-binding/permease protein MacB |
UniProt ID | Q5HVG3 |
◆ Recombinant Proteins | ||
TMEM81-9427M | Recombinant Mouse TMEM81 Protein, His (Fc)-Avi-tagged | +Inquiry |
MYF6-6741HF | Recombinant Full Length Human MYF6 Protein, GST-tagged | +Inquiry |
VAC14-9988M | Recombinant Mouse VAC14 Protein, His (Fc)-Avi-tagged | +Inquiry |
PCDHGB3-1570H | Recombinant Human PCDHGB3, His-tagged | +Inquiry |
NRM-4219Z | Recombinant Zebrafish NRM | +Inquiry |
◆ Native Proteins | ||
COL3A1-18B | Native Bovine COL3A1 Protein | +Inquiry |
IgA-248A | Native Alpaca Immunoglobulin A | +Inquiry |
Hemoglobin Glutamer-01B | Native Bovine Hemoglobin Glutamer | +Inquiry |
Fibrinogen-71R | Active Native Rabbit Fibrinogen | +Inquiry |
OAC-34 | Active Native Oxaloacetate decarboxylase | +Inquiry |
◆ Cell & Tissue Lysates | ||
LINC01588-389HCL | Recombinant Human LINC01588 lysate | +Inquiry |
BNIP1-8425HCL | Recombinant Human BNIP1 293 Cell Lysate | +Inquiry |
XRCC6BP1-252HCL | Recombinant Human XRCC6BP1 293 Cell Lysate | +Inquiry |
SFXN2-1894HCL | Recombinant Human SFXN2 293 Cell Lysate | +Inquiry |
IL37-5237HCL | Recombinant Human IL1F7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All macB Products
Required fields are marked with *
My Review for All macB Products
Required fields are marked with *
0
Inquiry Basket